H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000036289 Accession number: BC013583 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Signal recognition particle receptor subunit alpha; SR-alpha; Docking protein alpha; DP-alpha;
 
 

Transcript original information
Accession number BC013583.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:9571 IMAGE:3877676
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (SRPR) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (SRPR);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 2991[bp] (No. of exon:14)[A:753 T:707 G:760 C:771]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Lung, large cell carcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 2977(+) Signal: 2961-2965(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0010252
Genomic location  G-integra Help Chromosome 11
Location 11q24.2
Position 126132835- 126138783
Strand -
Possible duplicated location(s) NA
Gene structure 14 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:6734
KEGG GENES KEGG GENES(6734)
GeneCard GeneCardSRPR*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000071425
Predicted CDS 85..2001;  638[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.767
Database links RefSeq NP_003130
UniProt P08240
CCDS CCDS31717

Motif information
ORF

length(638),orf(85:2001)
MLDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHE
ALTLKYKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQ
QSALSLLNGTFDFQNDFLRLLREAEESSKIRAPTTMKKFEDSEKAKKPVR
SMIETRGEKPKEKAKNSKKKGAKKEGSDGPLATSKPVPAEKSGLPVGPEN
GVELSKEELIRRKREEFIQKHGRGMEKSNKSTKSDAPKEKGKKAPRVWEL
GGCANKEVLDYSTPTTNGTPEAALSEDINLIRGTGSGGQLQDLDCSSSDD
EGAAQNSTKPSATKGTLGGMFGMLKGLVGSKSLSREDMESVLDKMRDHLI
AKNVAADIAVQLCESVANKLEGKVMGTFSTVTSTVKQALQESLVQILQPQ
RRVDMLRDIMDAQRRQRPYVVTFCGVNGVGKSTNLAKISFWLLENGFSVL
IAACDTFRAGAVEQLRTHTRRLSALHPPEKHGGRTMVQLFEKGYGKDAAG
IAMEAIAFARNQGFDVVLVDTAGRMQDNAPLMTALAKLITVNTPDLVLFV
GEALVGNEAVDQLVKFNRALADHSMAQTPRLIDGIVLTKFDTIDDKVGAA
ISMTYITSKPIVFVGTGQTYCDLRSLNAKAVVAALMKA*
a.a.
length
InterPro Name
length(128), motif(1:128) 128 IPR011012 Longin-like domain [Domain]
length(275), motif(27:301) 275 IPR007222 Signal recognition particle receptor, alpha subunit, N-terminal [Domain]
length(81), motif(319:399) 81 IPR013822 Signal recognition particle, SRP54 subunit, helical bundle [Domain]
length(78), motif(320:397) 78 IPR013822 Signal recognition particle, SRP54 subunit, helical bundle [Domain]
length(73), motif(321:393) 73 IPR013822 Signal recognition particle, SRP54 subunit, helical bundle [Domain]
length(221), motif(416:636) 221 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(154), motif(417:570) 154 IPR003593 AAA+ ATPase domain [Domain]
length(220), motif(418:637) 220 IPR000897 Signal recognition particle, SRP54 subunit, GTPase domain [Domain]
length(218), motif(419:636) 218 IPR000897 Signal recognition particle, SRP54 subunit, GTPase domain [Domain]
length(210), motif(428:637) 210 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(14), motif(610:623) 14 IPR000897 Signal recognition particle, SRP54 subunit, GTPase domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000036289
H-Inv cluster ID Locus viewHIX0010252
Accession number BC013583.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Signal recognition particle receptor subunit alpha; SR-alpha; Docking protein alpha; DP-alpha;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P08240)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 334053614702039154893341559245516439358165548111667570117081983186696482006823121269460ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol SRPR
HGNC aliases "signal recognition particle receptor ('docking protein')"
HGNC name signal recognition particle receptor (docking protein)
DDBJ SRPR
UniProt SRPR
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000071425
No. of interaction 6
Interaction partner(s) HIP000020366HIP000022103HIP000085801HIP000089477HIP000097598HIP000097945
BIND NA
DIP NA
MINT MINT-64905; 
HPRD 02923;  10199;  18009; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:6734
KEGG GENES KEGG GENES(6734)
GeneCard GeneCardSRPR*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function GTP binding (GO:0005525);  GTPase activity (GO:0003924);  signal recognition particle binding (GO:0005047); 
Biological process transport (GO:0006810);  SRP-dependent cotranslational protein targeting to membrane (GO:0006614);  intracellular protein transport (GO:0006886); 
Cellular component signal recognition particle receptor complex (GO:0005785); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear;  peroxisome;  Other; 
Target P signal peptide
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
1 129 2fh5A1 2e-52 98.4 122/122 d.110.4.4
333 526 1wruA2 1e-20 10.2 166/174 b.106.1.1
515 570 1o94D 3e-05 17.9 56/189 c.26.2.3
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA180908; 
Affymetrix
GeneChip
HG-Focus 200918_s_at; 
HG-U133 200917_s_at;  200918_s_at; 
HG-U133A 200917_s_at;  200918_s_at; 
HG-U133A_2 200917_s_at;  200918_s_at; 
HG-U133B NA
HG-U133_Plus_2 200917_s_at;  200918_s_at; 
HG-U95 36679_at;  82466_at; 
HG-U95A 36679_at; 
HG-U95B NA
HG-U95C NA
HG-U95D 82466_at; 
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3355044;  3355049;  3355051;  3355053;  3355055;  3396920;  3396921;  3396922;  3396923;  3396925;  3396926;  3396927;  3396930;  3396931;  3396933;  3396934;  3396935;  3396936;  3396938;  3396939;  3396940;  3396942;  3396943;  3396945;  3396947;  3396950;  3396951; 
HuGeneFL X06272_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P86943; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P86943;  A_24_P321369; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Gallus sp. (Chicken) AJ851760 G-integraG-integra
Orthology Mus sp. (Mouse) AK004967 MGI:1896656 G-integraG-integra
Orthology Rattus sp. (Rat) BC105782 G-integraG-integra
Orthology Bos sp. (Cow) ENSBTAT00000018762 G-integraG-integra
Orthology Danio sp. (Zebrafish) ENSDART00000086823 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000018398 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000004805 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00019549001 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000169874 G-integraG-integra
Orthology Canis sp. (Dog) X03184 G-integraG-integra
Orthology Macaca sp. (Macaque) XM_001112588 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001365512 G-integraG-integra
Orthology Equus sp. (Horse) XM_001505096 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XR_023972 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
29 .. 29 C/T rs12276901 - 5'UTR
71 .. 71 C/G rs199979024 - 5'UTR
175 .. 175 G/A rs144969041 - CDS Nonsynonymous[Ala31Thr]
198 .. 198 G/A rs149903952 - CDS Synonymous[Leu38Leu]
217 .. 217 A/T rs114635952 - CDS Nonsynonymous[Asn45Tyr]
221 .. 221 C/T rs139160584 - CDS Nonsynonymous[Ser46Phe]
240 .. 240 C/G rs1049664 + CDS Synonymous[Leu52Leu]
352 .. 352 T/G rs201245915 - CDS Nonsynonymous[Phe90Val]
388 ^ 389 -/A rs35862035 - CDS
432 .. 432 C/T rs115659458 - CDS Synonymous[Asp116Asp]
552 .. 552 G/A rs151190812 - CDS Synonymous[Arg156Arg]
553 .. 553 G/A rs144530471 - CDS Nonsynonymous[Gly157Arg]
557 .. 557 A/C rs200922787 - CDS Nonsynonymous[Glu158Ala]
617 .. 617 A/G rs147248453 - CDS Nonsynonymous[Asp178Gly]
716 .. 716 G/A rs143879786 - CDS Nonsynonymous[Arg211His]
730 .. 730 G/A rs201027361 - CDS Nonsynonymous[Glu216Lys]
779 .. 779 C/T rs148507841 - CDS Nonsynonymous[Thr232Met]
782 .. 782 A/T rs202172265 - CDS Nonsynonymous[Lys233Met]
824 ^ 825 -/G rs34271565 - CDS
842 .. 842 G/C rs144749540 - CDS Nonsynonymous[Cys253Ser]
852 .. 852 A/G rs201070365 - CDS Synonymous[Lys256Lys]
877 .. 877 A/G rs149373055 - CDS Nonsynonymous[Thr265Ala]
923 .. 923 T/A rs201818150 - CDS Nonsynonymous[Leu280Gln]
929 .. 929 G/A rs115461150 - CDS Nonsynonymous[Arg282Gln]
935 .. 935 C/G rs114697024 - CDS Nonsynonymous[Thr284Ser]
984 .. 984 C/T rs116309621 - CDS Synonymous[Asp300Asp]
991 .. 991 G/A rs145094530 - CDS Nonsynonymous[Ala303Thr]
1006 .. 1006 A/G rs199942610 - CDS Nonsynonymous[Thr308Ala]
1010 .. 1010 A/G rs143064501 - CDS Nonsynonymous[Lys309Arg]
1019 .. 1019 C/T rs138456100 - CDS Nonsynonymous[Ala312Val]
1020 .. 1020 G/A rs2962118 + CDS Synonymous[Ala312Ala]
1075 .. 1075 A/C rs199928419 - CDS Nonsynonymous[Lys331Gln]
1079 .. 1079 G/T rs140747977 - CDS Nonsynonymous[Ser332Ile]
1085 .. 1085 G/C rs150925570 - CDS Nonsynonymous[Ser334Thr]
1087 .. 1087 C/T rs143514827 - CDS Nonsynonymous[Arg335Cys]
1143 .. 1143 C/T rs75918778 - CDS Synonymous[Asn353Asn]
1161 .. 1161 C/T rs115103516 - CDS Synonymous[Ala359Ala]
1162 .. 1162 G/A/T rs11539390 + CDS
1167 .. 1167 G/T rs115359130 - CDS Nonsynonymous[Gln361His]
1191 .. 1191 G/T rs144360596 - CDS Nonsynonymous[Lys369Asn]
1215 .. 1215 G/A rs116742033 - CDS Synonymous[Thr377Thr]
1224 .. 1224 G/A rs200174931 - CDS Synonymous[Thr380Thr]
1228 .. 1228 A/G rs147654252 - CDS Nonsynonymous[Thr382Ala]
1260 .. 1260 C/T rs145286251 - CDS Synonymous[Ser392Ser]
1261 .. 1261 C/T rs189596914 - CDS Synonymous[Leu393Leu]
1285 .. 1285 C/T rs139273547 - CDS Nonsynonymous[Arg401Cys]
1297 .. 1297 A/G rs150815595 - CDS Nonsynonymous[Met405Val]
1299 .. 1299 G/C rs142362732 - CDS Nonsynonymous[Met405Ile]
1303 .. 1303 C/T rs201236859 - CDS Nonsynonymous[Arg407Trp]
1320 .. 1320 C/T rs148731597 - CDS Synonymous[Ala412Ala]
1334 .. 1334 G/A rs201079010 - CDS Nonsynonymous[Arg417His]
1347 .. 1347 C/T rs184362962 - CDS Synonymous[Val421Val]
1425 .. 1425 C/T rs199665407 - CDS Synonymous[Phe447Phe]
1438 .. 1438 G/A rs192504159 - CDS Nonsynonymous[Ala452Thr]
1467 .. 1467 C/T rs111460748 - CDS Synonymous[Ala461Ala]
1503 .. 1503 T/G rs199983442 - CDS Nonsynonymous[Ser473Arg]
1532 .. 1532 G/A rs114538197 - CDS Nonsynonymous[Gly483Asp]
1534 .. 1534 C/T rs142997401 - CDS Nonsynonymous[Arg484Cys]
1538 .. 1538 C/T rs115391980 - CDS Nonsynonymous[Thr485Ile]
1572 .. 1572 G/A rs115509849 - CDS Synonymous[Lys496Lys]
1599 .. 1599 C/T rs146400745 - CDS Synonymous[Ala505Ala]
1629 .. 1629 C/T rs149426729 - CDS Synonymous[Asp515Asp]
1632 .. 1632 G/C rs200827593 - CDS Synonymous[Val516Val]
1663 .. 1663 G/C rs199583502 - CDS Nonsynonymous[Asp527His]
1813 .. 1813 C/T rs17850298 - CDS AA-STOP[Gln577*]
1837 .. 1837 A/G rs200530292 - CDS Nonsynonymous[Ile585Val]
1883 .. 1883 C/T rs114071597 - CDS Nonsynonymous[Ala600Val]
1885 .. 1885 A/G rs2230546 + CDS Nonsynonymous[Ile601Val]
1896 .. 1896 G/A rs189799996 - CDS Synonymous[Thr604Thr]
1914 .. 1914 C/G rs116418767 - CDS Synonymous[Pro610Pro]
1917 .. 1917 C/T rs137920723 - CDS Synonymous[Ile611Ile]
1918 .. 1918 G/A rs149620514 - CDS Nonsynonymous[Val612Ile]
2142 .. 2142 C/T/G rs2242390 - 3'UTR
2171 .. 2171 T/C rs529328 + 3'UTR
2180 .. 2180 A/G rs1049665 + 3'UTR
2224 .. 2224 C/T rs55944421 - 3'UTR
2225 .. 2225 G/T rs3189850 + 3'UTR
2236 .. 2236 T/C rs1049666 + 3'UTR
2251 .. 2251 C/T rs11602294 - 3'UTR
2389 .. 2389 A/C rs191878084 - 3'UTR
2399 .. 2399 A/G rs141601067 - 3'UTR
2411 .. 2411 G/T rs138984465 - 3'UTR
2475 .. 2475 G/A rs147247599 - 3'UTR
2604 .. 2604 G/-/T rs9106 - 3'UTR
2604 .. 2604 G/T/C rs75664851 - 3'UTR
2630 .. 2630 T/G rs17656 - 3'UTR
2633 .. 2633 C/T rs75383146 - 3'UTR
2655 .. 2655 G/C rs112255862 - 3'UTR
2888 .. 2888 A/G rs187462910 - 3'UTR
2890 .. 2890 A/C rs15240 + 3'UTR
2942 .. 2942 T/G rs3781768 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer