H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000036289 Accession number: BC013583 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Signal recognition particle receptor subunit alpha; SR-alpha; Docking protein alpha; DP-alpha;
 
 

Motif information
ORF

length(638),orf(85:2001)
MLDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHE
ALTLKYKLDNQFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQ
QSALSLLNGTFDFQNDFLRLLREAEESSKIRAPTTMKKFEDSEKAKKPVR
SMIETRGEKPKEKAKNSKKKGAKKEGSDGPLATSKPVPAEKSGLPVGPEN
GVELSKEELIRRKREEFIQKHGRGMEKSNKSTKSDAPKEKGKKAPRVWEL
GGCANKEVLDYSTPTTNGTPEAALSEDINLIRGTGSGGQLQDLDCSSSDD
EGAAQNSTKPSATKGTLGGMFGMLKGLVGSKSLSREDMESVLDKMRDHLI
AKNVAADIAVQLCESVANKLEGKVMGTFSTVTSTVKQALQESLVQILQPQ
RRVDMLRDIMDAQRRQRPYVVTFCGVNGVGKSTNLAKISFWLLENGFSVL
IAACDTFRAGAVEQLRTHTRRLSALHPPEKHGGRTMVQLFEKGYGKDAAG
IAMEAIAFARNQGFDVVLVDTAGRMQDNAPLMTALAKLITVNTPDLVLFV
GEALVGNEAVDQLVKFNRALADHSMAQTPRLIDGIVLTKFDTIDDKVGAA
ISMTYITSKPIVFVGTGQTYCDLRSLNAKAVVAALMKA*
a.a.
length
InterPro Name
length(128), motif(1:128) 128 IPR011012 Longin-like domain [Domain]
length(275), motif(27:301) 275 IPR007222 Signal recognition particle receptor, alpha subunit, N-terminal [Domain]
length(81), motif(319:399) 81 IPR013822 Signal recognition particle, SRP54 subunit, helical bundle [Domain]
length(78), motif(320:397) 78 IPR013822 Signal recognition particle, SRP54 subunit, helical bundle [Domain]
length(73), motif(321:393) 73 IPR013822 Signal recognition particle, SRP54 subunit, helical bundle [Domain]
length(221), motif(416:636) 221 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(154), motif(417:570) 154 IPR003593 AAA+ ATPase domain [Domain]
length(220), motif(418:637) 220 IPR000897 Signal recognition particle, SRP54 subunit, GTPase domain [Domain]
length(218), motif(419:636) 218 IPR000897 Signal recognition particle, SRP54 subunit, GTPase domain [Domain]
length(210), motif(428:637) 210 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(14), motif(610:623) 14 IPR000897 Signal recognition particle, SRP54 subunit, GTPase domain [Domain]