H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000036789 Accession number: BC014580 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Sorting nexin-3; Protein SDP3;
 
 

Motif information
ORF

length(162),orf(122:610)
MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYE
IRVKTNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQ
LPFRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEII
DKSYTPSKIRHA*
a.a.
length
InterPro Name
length(124), motif(24:147) 124 IPR001683 Phox homologous domain [Domain]
length(124), motif(25:148) 124 IPR001683 Phox homologous domain [Domain]
length(123), motif(26:148) 123 IPR001683 Phox homologous domain [Domain]
length(125), motif(27:151) 125 IPR001683 Phox homologous domain [Domain]
length(121), motif(27:147) 121 IPR001683 Phox homologous domain [Domain]