H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000037340 Accession number: BC015809 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: DnaJ homolog subfamily A member 2; Cell cycle progression restoration gene 3 protein; Dnj3; Dj3; HIRA-interacting protein 4; Renal carcinoma antigen NY-REN-14; Precursor;
 
 

Transcript original information
Accession number BC015809.2
CAGE tag ID NA
EST ID NA
Clone Number MGC:9488 IMAGE:3922477
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 2023[bp] (No. of exon:9)[A:623 T:551 G:485 C:364]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Skin, melanotic melanoma.
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence GCCGCCATGG
PolyA Site: 1980(+) Signal: 1956-1960(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0013004
Genomic location  G-integra Help Chromosome 16
Location 16q11.2-16q12.1
Position 46990294- 47007578
Strand -
Possible duplicated location(s) NA
Gene structure 9 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:10294
KEGG GENES KEGG GENES(10294)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000030880
Predicted CDS 96..1334;  412[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.729
Database links RefSeq NP_005871
UniProt O60884
CCDS CCDS10726

Motif information
ORF

length(412),orf(96:1334)
MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEI
SFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMDDIFSHIFGGGLFGFM
GNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSACSGQG
GKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKD
RCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVL
LLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDGRQIVVKYPP
GKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSE
LEDLLPSRPEVPNIIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESS
SHHGPGVQCAHQ*
a.a.
length
InterPro Name
length(92), motif(4:95) 92 IPR001623 DnaJ domain [Domain]
length(97), motif(5:101) 97 IPR001623 DnaJ domain [Domain]
length(56), motif(7:62) 56 IPR001623 DnaJ domain [Domain]
length(63), motif(8:70) 63 IPR001623 DnaJ domain [Domain]
length(59), motif(9:67) 59 IPR001623 DnaJ domain [Domain]
length(19), motif(10:28) 19 IPR001623 DnaJ domain [Domain]
length(16), motif(28:43) 16 IPR001623 DnaJ domain [Domain]
length(20), motif(47:66) 20 IPR018253 DnaJ domain, conserved site [Conserved_site]
length(20), motif(62:81) 20 IPR001623 DnaJ domain [Domain]
length(35), motif(114:148) 35 IPR008971 HSP40/DnaJ peptide-binding [Domain]
length(85), motif(130:214) 85 IPR001305 Heat shock protein DnaJ, cysteine-rich domain [Domain]
length(73), motif(140:212) 73 IPR001305 Heat shock protein DnaJ, cysteine-rich domain [Domain]
length(67), motif(143:209) 67 IPR001305 Heat shock protein DnaJ, cysteine-rich domain [Domain]
length(66), motif(144:209) 66 IPR001305 Heat shock protein DnaJ, cysteine-rich domain [Domain]
length(44), motif(215:258) 44 IPR008971 HSP40/DnaJ peptide-binding [Domain]
length(88), motif(259:346) 88 IPR008971 HSP40/DnaJ peptide-binding [Domain]
length(75), motif(266:340) 75 IPR002939 Chaperone DnaJ, C-terminal [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000037340
H-Inv cluster ID Locus viewHIX0013004
Accession number BC015809.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript; 
Coding potential  Help Protein coding; 
Definition DnaJ homolog subfamily A member 2; Cell cycle progression restoration gene 3 protein; Dnj3; Dj3; HIRA-interacting protein 4; Renal carcinoma antigen NY-REN-14; Precursor;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (O60884)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 9383053105084791081657314702039153087741548933417081983196903322006823121269460ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ DNAJA2
UniProt DNAJA2
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000030880
No. of interaction 9
Interaction partner(s) HIP000027496HIP000030343HIP000054110HIP000072242HIP000085662HIP000092109HIP000106180HIP000108521HIP000142612
BIND NA
DIP 177026E;  179491E;  185272E; 
MINT MINT-6488488; 
HPRD 00579;  00774;  00777;  00913;  01818;  01852;  03883;  04043;  04045;  04157;  06784;  06942;  11821;  11915;  11921;  13662;  14358;  18212; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:10294
KEGG GENES KEGG GENES(10294)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function heat shock protein binding (GO:0031072);  unfolded protein binding (GO:0051082); 
Biological process protein folding (GO:0006457); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear;  extracellular;  mitochondria; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
7 69 2nraC1 3e-22 14.3 63/135 a.4.5.10
139 201 1nltA3 1e-13 45.2 62/74 g.54.1.1
217 373 2d7vA1 6e-31 10.1 148/155 d.227.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA151503;  AGhsB230113; 
Affymetrix
GeneChip
HG-Focus 209157_at; 
HG-U133 209157_at; 
HG-U133A 209157_at; 
HG-U133A_2 209157_at; 
HG-U133B NA
HG-U133_Plus_2 209157_at; 
HG-U95 34201_at; 
HG-U95A 34201_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3659048;  3659050;  3659053;  3659054;  3659055;  3690087;  3690088;  3690089;  3690090;  3690091;  3690092;  3690095;  3690096;  3690099;  3690100;  3690101;  3690103;  3690105;  3690108;  3690109; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P15083; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P15090; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Mus sp. (Mouse) AB028853 G-integraG-integra
Orthology Macaca sp. (Macaque) AB174448 G-integraG-integra
Orthology Danio sp. (Zebrafish) BC045437 G-integraG-integra
Orthology Rattus sp. (Rat) BC087010 G-integraG-integra
Orthology Bos sp. (Cow) BC113244 G-integraG-integra
Orthology Canis sp. (Dog) ENSCAFT00000016309 G-integraG-integra
Orthology Equus sp. (Horse) ENSECAT00000009832 G-integraG-integra
Orthology Gallus sp. (Chicken) ENSGALT00000039559 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000011606 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000018899 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000008608 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00035563001 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000129961 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000140391 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001363240 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XM_528644 G-integraG-integra
Orthology Canis sp. (Dog) XM_535319 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
77 .. 77 C/T rs200272438 - 5'UTR
104 .. 104 C/T rs148359826 - CDS Synonymous[Asn3Asn]
107 .. 107 G/A rs114647695 - CDS Synonymous[Val4Val]
146 .. 146 C/T rs143068034 - CDS Synonymous[Pro17Pro]
194 .. 194 G/A rs149065795 - CDS Synonymous[Lys33Lys]
219 .. 219 A/G rs202243022 - CDS Nonsynonymous[Asn42Asp]
332 .. 332 C/T rs144876450 - CDS Synonymous[Gly79Gly]
372 .. 372 G/T rs1065332 + CDS Nonsynonymous[Gly93Cys]
415 .. 415 G/A rs143994918 - CDS Nonsynonymous[Arg107Gln]
430 .. 430 G/C rs11547685 + CDS Nonsynonymous[Arg112Thr]
508 .. 508 G/T rs1045650 + CDS Nonsynonymous[Ser138Ile]
597 .. 597 C/T rs140371161 - CDS Nonsynonymous[Arg168Cys]
692 .. 692 A/T rs200039226 - CDS Nonsynonymous[Lys199Asn]
830 .. 830 C/T rs181738156 - CDS Synonymous[Pro245Pro]
842 .. 842 T/A rs146753291 - CDS Synonymous[Val249Val]
851 .. 851 A/G rs143516699 - CDS Synonymous[Leu252Leu]
853 .. 853 A/G rs139905768 - CDS Nonsynonymous[Gln253Arg]
872 .. 872 A/G rs150568076 - CDS Synonymous[Val259Val]
899 .. 899 C/T rs147416569 - CDS Synonymous[His268His]
921 .. 921 G/A rs199942539 - CDS Nonsynonymous[Val276Ile]
944 .. 944 G/A rs200818972 - CDS Synonymous[Gln283Gln]
1016 .. 1016 G/A rs142308620 - CDS Synonymous[Gly307Gly]
1106 .. 1106 T/C rs186339002 - CDS Synonymous[Phe337Phe]
1113 .. 1113 A/G rs200198931 - CDS Nonsynonymous[Asn340Asp]
1115 .. 1115 C/T rs148745889 - CDS Synonymous[Asn340Asn]
1258 .. 1258 G/A rs200288545 - CDS Nonsynonymous[Arg388His]
1416 .. 1416 T/G rs114487971 - 3'UTR
1491 .. 1491 A/G rs192293812 - 3'UTR
1494 .. 1494 A/T rs12836 - 3'UTR
1519 .. 1519 A/G rs187678402 - 3'UTR
1881 .. 1881 T/G rs142894389 - 3'UTR
1903 .. 1903 C/T rs200182056 - 3'UTR
1910 .. 1910 C/T rs201781640 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer