H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000037802 Accession number: BC017040 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Protein C-ets-2;
 
 

Motif information
ORF

length(469),orf(163:1572)
MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQ
EVPTGLDSISHDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIP
KNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLEL
APDFVGDILWEHLEQMIKENQEKTEDQYEENSHLTSVPHWINSNTLGFGT
EQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFPKSRLSSVSVT
YCSVSQDFPGSNLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQS
SLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIP
AAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVA
RRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLL
GFTPEELHAILGVQPDTED*
a.a.
length
InterPro Name
length(102), motif(66:167) 102 IPR013761 Sterile alpha motif/pointed domain [Domain]
length(90), motif(81:170) 90 IPR013761 Sterile alpha motif/pointed domain [Domain]
length(86), motif(85:170) 86 IPR003118 Pointed domain [Domain]
length(84), motif(87:170) 84 IPR003118 Pointed domain [Domain]
length(82), motif(88:169) 82 IPR003118 Pointed domain [Domain]
length(121), motif(346:466) 121 IPR011991 Winged helix-turn-helix DNA-binding domain [Domain]
length(86), motif(362:447) 86 IPR000418 Ets domain [Domain]
length(14), motif(363:376) 14 IPR000418 Ets domain [Domain]
length(82), motif(363:444) 82 IPR000418 Ets domain [Domain]
length(81), motif(363:443) 81 IPR000418 Ets domain [Domain]
length(9), motif(365:373) 9 IPR000418 Ets domain [Domain]
length(19), motif(387:405) 19 IPR000418 Ets domain [Domain]
length(19), motif(406:424) 19 IPR000418 Ets domain [Domain]
length(16), motif(409:424) 16 IPR000418 Ets domain [Domain]
length(19), motif(425:443) 19 IPR000418 Ets domain [Domain]