H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000039055 Accession number: BC020968 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: C-X-C chemokine receptor type 4; CXC-R4; CXCR-4; FB22; Fusin; HM89; LCR1; Leukocyte-derived seven transmembrane domain receptor; LESTR; NPYRL; Stromal cell-derived factor 1 receptor; SDF-1 receptor; AltName: CD_antigen=CD184;
 
 

Motif information
ORF

length(352),orf(54:1112)
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFL
TGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVA
NWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKL
LAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQ
FQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFA
CWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFH
SS*
a.a.
length
InterPro Name
length(352), motif(1:352) 352 IPR001277 CXC chemokine receptor 4 [Family]
length(352), motif(1:352) 352 IPR000355 Chemokine receptor family [Family]
length(32), motif(6:37) 32 IPR022726 CXC chemokine receptor 4 N-terminal domain [Domain]
length(17), motif(17:33) 17 IPR001277 CXC chemokine receptor 4 [Family]
length(298), motif(25:322) 298 IPR017452 GPCR, rhodopsin-like, 7TM [Domain]
length(19), motif(28:46) 19 IPR000355 Chemokine receptor family [Family]
length(16), motif(33:48) 16 IPR001277 CXC chemokine receptor 4 [Family]
length(25), motif(40:64) 25 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(248), motif(55:302) 248 IPR017452 GPCR, rhodopsin-like, 7TM [Domain]
length(248), motif(55:302) 248 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(17), motif(63:79) 17 IPR001277 CXC chemokine receptor 4 [Family]
length(14), motif(63:76) 14 IPR000355 Chemokine receptor family [Family]
length(22), motif(73:94) 22 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(11), motif(87:97) 11 IPR000355 Chemokine receptor family [Family]
length(16), motif(100:115) 16 IPR001277 CXC chemokine receptor 4 [Family]
length(14), motif(113:126) 14 IPR000355 Chemokine receptor family [Family]
length(23), motif(116:138) 23 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(17), motif(122:138) 17 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(12), motif(136:147) 12 IPR001277 CXC chemokine receptor 4 [Family]
length(22), motif(152:173) 22 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(21), motif(181:201) 21 IPR001277 CXC chemokine receptor 4 [Family]
length(24), motif(200:223) 24 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(18), motif(224:241) 18 IPR001277 CXC chemokine receptor 4 [Family]
length(25), motif(237:261) 25 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(15), motif(270:284) 15 IPR001277 CXC chemokine receptor 4 [Family]
length(15), motif(280:294) 15 IPR000355 Chemokine receptor family [Family]
length(27), motif(284:310) 27 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(15), motif(304:318) 15 IPR000355 Chemokine receptor family [Family]
length(19), motif(322:340) 19 IPR001277 CXC chemokine receptor 4 [Family]