H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000040910 Accession number: BC029886 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Occludin;
 
 

Motif information
ORF

length(522),orf(179:1747)
MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED
EILHFYKWTSPPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGG
SVGYPYGGSGFGSYGSGYGYGYGYGYGYGGYTDPRAAKGFMLAMAAFCFI
AALVIFVTSVIRSEMSRTRRYYLSVIIVSAILGIMVFIATIVYIMGVNPT
AQSSGSLYGSQIYALCNQFYTPAATGLYVDQYSYHYCVVDPQEAIAIVLG
FMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN
VSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEV
VQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYET
DYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSEL
DEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHC
KQLKSKLSHIKKMVGDYDRQKT*
a.a.
length
InterPro Name
length(507), motif(15:521) 507 IPR002958 Occludin [Family]
length(9), motif(55:63) 9 IPR002958 Occludin [Family]
length(207), motif(57:263) 207 IPR008253 Marvel domain [Domain]
length(210), motif(60:269) 210 IPR008253 Marvel domain [Domain]
length(8), motif(166:173) 8 IPR002958 Occludin [Family]
length(8), motif(294:301) 8 IPR002958 Occludin [Family]
length(7), motif(398:404) 7 IPR002958 Occludin [Family]
length(100), motif(420:519) 100 IPR010844 Occludin/RNA polymerase II elongation factor, ELL domain [Domain]
length(7), motif(420:426) 7 IPR002958 Occludin [Family]