H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000041112 Accession number: BC030703 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Phospholipase DDHD1 isoform a.
 
 

Transcript original information
Accession number BC030703.2
CAGE tag ID NA
EST ID NA
Clone Number MGC:26960 IMAGE:4823200
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 3563[bp] (No. of exon:12)[A:1001 T:890 G:882 C:790]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Testis
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 3547(+) Signal: 3524-3528(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0011666
Genomic location  G-integra Help Chromosome 14
Location 14q22.1
Position 53512742- 53620000
Strand -
Possible duplicated location(s) NA
Gene structure 12 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:80821
KEGG GENES KEGG GENES(80821)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000082333
Predicted CDS 185..2803;  872[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.729

Motif information
ORF

length(872),orf(185:2803)
MNYPGRGSPRSPEHNGRGGGGGAWELGSDARPAFGGGVCCFEHLPGGDPD
DGDVPLALLRGEPGLHLAPGTDDHNHHLALDPCLSDENYDFSSAESGSSL
RYYSEGESGGGGSSLSLHPPQQPPLVPTNSGGGGATGGSPGERKRTRLGG
PAARHRYEVVTELGPEEVRWFYKEDKKTWKPFIGYDSLRIELAFRTLLQT
TGARPQGGDRDGDHVCSPTGPASSSGEDDDEDRACGFCQSTTGHEPEMVE
LVNIEPVCVRGGLYEVDVTQGECYPVYWNQADKIPVMRGQWFIDGTWQPL
EEEESNLIEQEHLNCFRGQQMQENFDIEVSKSIDGKDAVHSFKLSRNHVD
WHSVDEVYLYSDATTSKIARTVTQKLGFSKASSSGTRLHRGYVEEATLED
KPSQTTHIVFVVHGIGQKMDQGRIIKNTAMMREAARKIEERHFSNHATHV
EFLPVEWRSKLTLDGDTVDSITPDKVRGLRDMLNSSAMDIMYYTSPLYRD
ELVKGLQQELNRLYSLFCSRNPDFEEKGGKVSIVSHSLGCVITYDIMTGW
NPVRLYEQLLQKEEELPDERWMSYEERHLLDELYITKRRLKEIEERLHGL
KASSMTQTPALKFKVENFFCMGSPLAVFLALRGIRPGNTGSQDHILPREI
CNRLLNIFHPTDPVAYRLEPLILKRYSNISPVQIHWYNTSNPLPYEHMKP
SFLNPAKEPTSVSENEGISTIPSPVTSPVLSRRHYGESITNIGKASILGA
ASIGKGLGGMLFSRFGRSSTTQSSETSKDSMEDEKKPVASPSATTVGTQT
LPHSSSGFLDSALELDHRIDFELREGLVESRYWSAVTSHTAYWSSLDVAL
FLLTFMYKHEHDDDAKPNLDPI*
a.a.
length
InterPro Name
length(248), motif(611:858) 248 IPR004177 DDHD [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000041112
H-Inv cluster ID Locus viewHIX0011666
Accession number BC030703.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Similar to Phospholipase DDHD1 isoform a.
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (NP_085140)  [Identity/coverage = 99.885%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ DDHD1
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000082333
No. of interaction 2
Interaction partner(s) HIP000045034HIP000071861
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:80821
KEGG GENES KEGG GENES(80821)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function metal ion binding (GO:0046872); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
149 195 1ujrA 5e-06 20.0 45/100 d.289.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsB201604;  AGhsC011322; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 225965_at;  225970_at;  243705_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 225965_at;  225970_at;  243705_at; 
HG-U133_Plus_2 225965_at;  225970_at;  243705_at; 
HG-U95 65183_at; 
HG-U95A NA
HG-U95B NA
HG-U95C 65183_at; 
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3536010;  3536011;  3536012;  3565003;  3565004;  3565010;  3565011;  3565012;  3565013;  3565014;  3565016;  3565018;  3565019;  3565020;  3565024;  3565026;  3565036;  3565045;  3565046;  3565047; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P205628; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P205623;  A_24_P911489; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
16 .. 16 G/A rs1959356 + 5'UTR
105 .. 105 C/T rs1105538 + 5'UTR
219 .. 219 C/A rs112672333 - CDS Nonsynonymous[Pro12His]
320 .. 320 G/A rs61985140 - CDS Nonsynonymous[Gly46Ser]
365 .. 365 G/C rs141632525 - CDS Nonsynonymous[Gly61Arg]
388 .. 388 G/A rs139727469 - CDS Synonymous[Ala68Ala]
420 .. 420 C/T rs184336796 - CDS Nonsynonymous[Ala79Val]
457 .. 457 C/T rs2358189 - CDS Synonymous[Phe91Phe]
501 .. 501 G/C rs117525276 - CDS Nonsynonymous[Gly106Ala]
506 ^ 507 -/GCGGCG rs55671452 - CDS
519 ^ 520 -/GGCGGC rs72341148 - CDS
520 ^ 521 -/GGCGGC rs140904345 - CDS
521 .. 521 A/G rs200797826 - CDS Nonsynonymous[Ser113Gly]
538 .. 538 C/T rs2358188 - CDS Synonymous[His118His]
632 .. 632 G/T rs73296180 - CDS Nonsynonymous[Gly150Cys]
636 .. 636 C/T rs201057717 - CDS Nonsynonymous[Pro151Leu]
637 .. 637 G/A rs141323589 - CDS Synonymous[Pro151Pro]
671 .. 671 C/T rs202213647 - CDS Synonymous[Leu163Leu]
683 .. 683 G/A rs35405770 - CDS Nonsynonymous[Glu167Lys]
725 .. 725 C/T rs143376013 - CDS Nonsynonymous[Pro181Ser]
745 .. 745 G/C rs1475810 + CDS Synonymous[Ser187Ser]
763 .. 763 C/T rs149564453 - CDS Synonymous[Ala193Ala]
812 .. 812 C/T rs138115281 - CDS Nonsynonymous[Arg210Trp]
821 .. 821 G/A rs150441319 - CDS Nonsynonymous[Asp213Asn]
855 .. 855 G/A rs141636646 - CDS Nonsynonymous[Ser224Asn]
872 .. 872 G/C rs147832037 - CDS Nonsynonymous[Asp230His]
884 .. 884 G/A rs200233648 - CDS Nonsynonymous[Ala234Thr]
913 .. 913 G/A rs113642168 - CDS Synonymous[Gly243Gly]
917 .. 917 G/A rs146006539 - CDS Nonsynonymous[Glu245Lys]
969 .. 969 G/T rs75333734 - CDS Nonsynonymous[Gly262Val]
1004 .. 1004 T/C rs142137313 - CDS Nonsynonymous[Tyr274His]
1020 .. 1020 A/G rs151013237 - CDS Nonsynonymous[Asn279Ser]
1066 .. 1066 C/T rs147569085 - CDS Synonymous[Asp294Asp]
1125 .. 1125 A/G rs148836546 - CDS Nonsynonymous[Asn314Ser]
1155 .. 1155 A/T rs200814513 - CDS Nonsynonymous[Asn324Ile]
1160 .. 1160 G/C rs145456012 - CDS Nonsynonymous[Asp326His]
1192 .. 1192 A/G rs143307366 - CDS Synonymous[Lys336Lys]
1194 .. 1194 A/T rs139853377 - CDS Nonsynonymous[Asp337Val]
1240 .. 1240 C/T rs145960430 - CDS Synonymous[His352His]
1304 .. 1304 C/A rs143813159 - CDS Nonsynonymous[Gln374Lys]
1375 .. 1375 A/G rs139838546 - CDS Synonymous[Thr397Thr]
1388 .. 1388 C/G rs150693025 - CDS Nonsynonymous[Pro402Ala]
1394 .. 1394 C/G rs79600461 - CDS Nonsynonymous[Gln404Glu]
1401 .. 1401 C/T rs142005917 - CDS Nonsynonymous[Thr406Ile]
1440 .. 1440 T/C rs148097244 - CDS Nonsynonymous[Met419Thr]
1534 .. 1534 T/C rs199958557 - CDS Synonymous[Val450Val]
1546 .. 1546 T/C rs147452605 - CDS Synonymous[Pro454Pro]
1645 .. 1645 A/G rs142971342 - CDS Synonymous[Ala487Ala]
1708 .. 1708 A/G rs138906273 - CDS Synonymous[Gln508Gln]
1711 .. 1711 G/A rs201393353 - CDS Synonymous[Glu509Glu]
1719 .. 1719 G/A rs146473667 - CDS Nonsynonymous[Arg512Gln]
1822 .. 1822 A/G rs142174102 - CDS Nonsynonymous[Ile546Met]
1850 .. 1850 T/G rs78160974 - CDS Nonsynonymous[Tyr556Asp]
1857 .. 1857 A/G rs199607183 - CDS Nonsynonymous[Gln558Arg]
1871 .. 1871 G/A rs199841916 - CDS Nonsynonymous[Glu563Lys]
1893 .. 1893 G/A rs114715404 - CDS Nonsynonymous[Arg570Gln]
1927 .. 1927 T/C rs201166214 - CDS Synonymous[Asp581Asp]
1942 .. 1942 T/A rs4898778 - CDS Synonymous[Thr586Thr]
1973 .. 1973 C/A rs140385346 - CDS Nonsynonymous[Leu597Ile]
2161 .. 2161 T/G rs201705902 - CDS Nonsynonymous[His659Gln]
2208 .. 2208 G/A rs17852816 - CDS Nonsynonymous[Arg675His]
2247 .. 2247 A/G rs151150383 - CDS Nonsynonymous[Asn688Ser]
2258 .. 2258 C/G rs149244454 - CDS Nonsynonymous[Pro692Ala]
2262 .. 2262 T/C rs200637587 - CDS Nonsynonymous[Leu693Ser]
2326 .. 2326 G/A rs199864462 - CDS Synonymous[Glu714Glu]
2379 .. 2379 G/A rs143188831 - CDS Nonsynonymous[Arg732His]
2382 .. 2382 G/A rs201550288 - CDS Nonsynonymous[Arg733Gln]
2565 .. 2565 C/A rs150538665 - CDS Nonsynonymous[Thr794Asn]
2566 .. 2566 C/A rs146456177 - CDS Synonymous[Thr794Thr]
2570 .. 2570 G/A rs184982008 - CDS Nonsynonymous[Val796Ile]
2592 .. 2592 A/G rs144016130 - CDS Nonsynonymous[His803Arg]
2611 .. 2611 C/T rs148782241 - CDS Synonymous[Leu809Leu]
2616 .. 2616 C/G rs193261227 - CDS Nonsynonymous[Ser811Cys]
2640 .. 2640 T/C rs184128645 - CDS Nonsynonymous[Ile819Thr]
2684 .. 2684 T/C rs112753891 - CDS Nonsynonymous[Ser834Pro]
2739 .. 2739 T/C rs15873 - CDS Nonsynonymous[Leu852Pro]
2754 .. 2754 A/G rs141960546 - CDS Nonsynonymous[Tyr857Cys]
2768 .. 2768 G/A rs202164262 - CDS Nonsynonymous[Asp862Asn]
2789 .. 2789 T/A rs192934516 - CDS Nonsynonymous[Leu869Ile]
2806 .. 2806 T/A rs199980471 - 3'UTR
2807 .. 2808 CT/-/TC rs3037072 - 3'UTR
2819 .. 2819 A/G rs112663760 - 3'UTR
2825 .. 2825 G/A rs199857671 - 3'UTR
2935 .. 2935 A/G rs150223358 - 3'UTR
2937 .. 2937 A/G rs140975422 - 3'UTR
2950 .. 2950 A/T rs7148136 - 3'UTR
2960 .. 2960 G/A rs200673884 - 3'UTR
2961 ^ 2962 -/A rs113463836 - 3'UTR
3161 .. 3161 A/G rs183766440 - 3'UTR
3434 .. 3434 T/C rs148254741 - 3'UTR
3451 .. 3451 C/T rs191717543 - 3'UTR
3452 .. 3452 C/G rs143125034 - 3'UTR
3458 .. 3458 T/C rs199844954 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer