H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000041112 Accession number: BC030703 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Phospholipase DDHD1 isoform a.
 
 

Motif information
ORF

length(872),orf(185:2803)
MNYPGRGSPRSPEHNGRGGGGGAWELGSDARPAFGGGVCCFEHLPGGDPD
DGDVPLALLRGEPGLHLAPGTDDHNHHLALDPCLSDENYDFSSAESGSSL
RYYSEGESGGGGSSLSLHPPQQPPLVPTNSGGGGATGGSPGERKRTRLGG
PAARHRYEVVTELGPEEVRWFYKEDKKTWKPFIGYDSLRIELAFRTLLQT
TGARPQGGDRDGDHVCSPTGPASSSGEDDDEDRACGFCQSTTGHEPEMVE
LVNIEPVCVRGGLYEVDVTQGECYPVYWNQADKIPVMRGQWFIDGTWQPL
EEEESNLIEQEHLNCFRGQQMQENFDIEVSKSIDGKDAVHSFKLSRNHVD
WHSVDEVYLYSDATTSKIARTVTQKLGFSKASSSGTRLHRGYVEEATLED
KPSQTTHIVFVVHGIGQKMDQGRIIKNTAMMREAARKIEERHFSNHATHV
EFLPVEWRSKLTLDGDTVDSITPDKVRGLRDMLNSSAMDIMYYTSPLYRD
ELVKGLQQELNRLYSLFCSRNPDFEEKGGKVSIVSHSLGCVITYDIMTGW
NPVRLYEQLLQKEEELPDERWMSYEERHLLDELYITKRRLKEIEERLHGL
KASSMTQTPALKFKVENFFCMGSPLAVFLALRGIRPGNTGSQDHILPREI
CNRLLNIFHPTDPVAYRLEPLILKRYSNISPVQIHWYNTSNPLPYEHMKP
SFLNPAKEPTSVSENEGISTIPSPVTSPVLSRRHYGESITNIGKASILGA
ASIGKGLGGMLFSRFGRSSTTQSSETSKDSMEDEKKPVASPSATTVGTQT
LPHSSSGFLDSALELDHRIDFELREGLVESRYWSAVTSHTAYWSSLDVAL
FLLTFMYKHEHDDDAKPNLDPI*
a.a.
length
InterPro Name
length(248), motif(611:858) 248 IPR004177 DDHD [Domain]