H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000041549 Accession number: BC032459 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Segment polarity protein dishevelled homolog DVL-3; Dishevelled-3; DSH homolog 3;
 
 

Transcript original information
Accession number BC032459.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:40316 IMAGE:5200610
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (DVL3) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (DVL3);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 2415[bp] (No. of exon:15)[A:565 T:404 G:666 C:780]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Brain, adult, 6 pooled whole brains
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 2340(+) Signal: 2321-2325(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0003920
Genomic location  G-integra Help Chromosome 3
Location 3q27.1
Position 183873356- 183888664
Strand +
Possible duplicated location(s) NA
Gene structure 15 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:1857
KEGG GENES KEGG GENES(1857)
GeneCard GeneCardDVL3*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000055993
Predicted CDS 69..2219;  716[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.822

Motif information
ORF

length(716),orf(69:2219)
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMD
DDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELP
PPMERTGGIGDSRPPSFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRD
GPEHATRLNGTAKGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSR
FSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITDSTMSLNIITV
TLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRS
EPIRPIDPAAWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTER
LDDFHLSIHSDMAAIVKAMASPESGLEVRDRMLLKITIPNAFIGSDVVDW
LYHNVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQCYYIFGDLCGN
MANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQYPPPPHPYNPH
PGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLASSLRSHHTH
PSYGPPGVPPLYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQS
FRMAMGNPSEFFVDVM*
a.a.
length
InterPro Name
length(716), motif(1:716) 716 IPR015506 Dishevelled-related protein [Family]
length(716), motif(1:716) 716 IPR008342 Dishevelled-3 [Family]
length(82), motif(1:82) 82 IPR001158 DIX domain [Domain]
length(79), motif(2:80) 79 IPR029071 Ubiquitin-related domain [Domain]
length(80), motif(2:81) 80 IPR001158 DIX domain [Domain]
length(72), motif(142:213) 72 IPR003351 Dishevelled protein domain [Domain]
length(115), motif(227:341) 115 IPR001478 PDZ domain [Domain]
length(111), motif(228:338) 111 IPR001478 PDZ domain [Domain]
length(73), motif(249:321) 73 IPR001478 PDZ domain [Domain]
length(84), motif(250:333) 84 IPR001478 PDZ domain [Domain]
length(80), motif(258:337) 80 IPR001478 PDZ domain [Domain]
length(15), motif(324:338) 15 IPR008339 Dishevelled family [Family]
length(13), motif(358:370) 13 IPR008339 Dishevelled family [Family]
length(99), motif(397:495) 99 IPR011991 Winged helix-turn-helix DNA-binding domain [Domain]
length(75), motif(422:496) 75 IPR000591 DEP domain [Domain]
length(70), motif(425:494) 70 IPR000591 DEP domain [Domain]
length(11), motif(453:463) 11 IPR008339 Dishevelled family [Family]
length(12), motif(479:490) 12 IPR008339 Dishevelled family [Family]
length(11), motif(499:509) 11 IPR008342 Dishevelled-3 [Family]
length(207), motif(500:706) 207 IPR024580 Dishevelled C-terminal [Domain]
length(10), motif(551:560) 10 IPR008342 Dishevelled-3 [Family]
length(12), motif(585:596) 12 IPR008342 Dishevelled-3 [Family]
length(12), motif(634:645) 12 IPR008342 Dishevelled-3 [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000041549
H-Inv cluster ID Locus viewHIX0003920
Accession number BC032459.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Segment polarity protein dishevelled homolog DVL-3; Dishevelled-3; DSH homolog 3;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q92997)  [Identity/coverage = 99.86%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 881732990395029192851934486112805222154893341567733316959974186696482022736621406692214222282261224622863007ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol DVL3
HGNC aliases "dishevelled 3 (homologous to Drosophila dsh)", "dishevelled, dsh homolog 3 (Drosophila)"
HGNC name dishevelled segment polarity protein 3
DDBJ DVL3
UniProt DVL3
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000055993
No. of interaction 37
Interaction partner(s) HIP000024053HIP000024110HIP000024174HIP000024846HIP000024846HIP000026846HIP000027692HIP000030159HIP000030159HIP000031618HIP000031656HIP000032348HIP000033272HIP000036198HIP000048111HIP000056415HIP000060617HIP000060647HIP000060721HIP000060867HIP000075961HIP000079240HIP000093195HIP000093195HIP000095247HIP000096070HIP000103175HIP000105951HIP000110849HIP000111933HIP000112988HIP000113911HIP000116808HIP000126774HIP000161736HIP000259815HIP000334477
BIND 149824;  178092;  178094;  178097;  178102; 
DIP 133824E;  136195E;  136212E; 
MINT MINT-60841; 
HPRD 00277;  00286;  01316;  01395;  01487;  02753;  02919;  02920;  03139;  03220;  03660;  03688;  04691;  04819;  06901;  07135;  07389;  08482;  08912;  10352;  11314;  12518;  12752;  13151;  13248;  13925;  15412;  16199;  17287;  17919;  18279;  18338; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:1857
KEGG GENES KEGG GENES(1857)
GeneCard GeneCardDVL3*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function protein binding (GO:0005515); 
Biological process Wnt receptor signaling pathway (GO:0016055); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
3 82 1wspA1 5e-18 32.1 78/83 d.15.1.8
247 335 1i16A 7e-21 30.6 85/130 b.36.1.2
403 496 1fshA 1e-26 72.3 94/94 a.4.5.31
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA230822; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 201907_x_at; 
HG-U133A 201907_x_at; 
HG-U133A_2 201907_x_at; 
HG-U133B NA
HG-U133_Plus_2 201907_x_at; 
HG-U95 NA
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2655440;  2655441;  2655444;  2655445;  2655446;  2655448;  2655452;  2655453;  2655454;  2655455;  2655458;  2655459;  2655461;  2655462;  2655463;  2655466;  2655467;  2655468;  2655469;  2655470;  2655471;  2655472;  2708394;  2708395; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_24_P283000; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
21 .. 21 G/C rs2971425 + 5'UTR
42 .. 42 C/G rs199803580 + 5'UTR
188 .. 188 C/T rs201408685 + CDS Synonymous[Pro40Pro]
250 .. 250 C/T rs143411607 + CDS Nonsynonymous[Ser61Leu]
353 .. 353 C/T rs147153174 + CDS Synonymous[Asn95Asn]
359 .. 359 G/A rs150288196 + CDS Synonymous[Ser97Ser]
374 .. 374 T/A rs142016012 + CDS Synonymous[Pro102Pro]
386 .. 386 G/A rs201100826 + CDS Synonymous[Thr106Thr]
395 .. 395 C/T rs150659339 + CDS Synonymous[Ile109Ile]
406 .. 406 G/A rs180953456 + CDS Nonsynonymous[Arg113Gln]
422 .. 422 C/T rs139857613 + CDS Synonymous[His118His]
463 .. 463 A/G rs143835194 + CDS Nonsynonymous[Asp132Gly]
473 .. 473 G/A rs1687251 + CDS Synonymous[Thr135Thr]
502 .. 502 G/A rs183681464 + CDS Nonsynonymous[Arg145Gln]
508 .. 508 G/A rs146812695 + CDS Nonsynonymous[Arg147His]
509 .. 509 C/A rs139649907 + CDS Synonymous[Arg147Arg]
525 .. 525 G/C rs1687252 + CDS Nonsynonymous[Glu153Gln]
529 .. 529 A/G rs144177739 + CDS Nonsynonymous[His154Arg]
534 .. 534 A/G rs201932377 + CDS Nonsynonymous[Thr156Ala]
538 .. 538 G/A rs146549809 + CDS Nonsynonymous[Arg157Gln]
555 ^ 556 -/A rs34111420 + CDS
557 .. 557 G/A rs13068292 + CDS Synonymous[Lys163Lys]
584 .. 584 T/C rs202225705 + CDS Synonymous[Gly172Gly]
591 .. 591 A/G rs149103009 + CDS Nonsynonymous[Ser175Gly]
641 .. 641 C/A rs143197489 + CDS Nonsynonymous[Asp191Glu]
661 .. 661 C/T rs151229784 + CDS Nonsynonymous[Thr198Ile]
696 .. 696 G/A rs200716382 + CDS Nonsynonymous[Ala210Thr]
729 .. 729 C/G rs76594728 + CDS Nonsynonymous[Arg221Gly]
730 .. 730 G/A rs199632718 + CDS Nonsynonymous[Arg221Gln]
749 .. 749 T/G rs9879096 + CDS Synonymous[Ser227Ser]
751 .. 751 G/A rs200798545 + CDS Nonsynonymous[Arg228Gln]
767 .. 767 G/A rs114642851 + CDS Synonymous[Ser233Ser]
805 .. 805 A/G rs201329929 + CDS Nonsynonymous[Asn246Ser]
806 .. 806 C/T rs146995023 + CDS Synonymous[Asn246Asn]
807 .. 807 A/G rs200772105 + CDS Nonsynonymous[Ile247Val]
814 .. 814 C/T rs200137383 + CDS Nonsynonymous[Thr249Met]
875 .. 875 C/T rs138011240 + CDS Synonymous[Asn269Asn]
879 .. 879 C/T rs142071816 + CDS Nonsynonymous[Arg271Cys]
888 .. 888 G/A rs199853617 + CDS Nonsynonymous[Gly274Ser]
920 .. 920 T/C rs201788751 + CDS Synonymous[Gly284Gly]
926 .. 926 C/T rs142819846 + CDS Synonymous[Ala286Ala]
945 .. 945 A/G rs201275800 + CDS Nonsynonymous[Ile293Val]
977 .. 977 C/T rs138393220 + CDS Synonymous[Asn303Asn]
986 .. 986 C/- rs34078554 + CDS
1045 .. 1045 C/T rs149251885 + CDS Nonsynonymous[Pro326Leu]
1046 .. 1046 G/A rs186597752 + CDS Synonymous[Pro326Pro]
1061 .. 1061 G/C rs144380814 + CDS Synonymous[Leu331Leu]
1099 .. 1099 G/A rs148386960 + CDS Nonsynonymous[Cys344Tyr]
1118 .. 1118 C/T rs200366490 + CDS Synonymous[Ser350Ser]
1128 .. 1128 C/T rs201442250 + CDS Nonsynonymous[Arg354Trp]
1161 .. 1161 A/G rs41266251 + CDS Nonsynonymous[Thr365Ala]
1169 .. 1169 C/T rs142140216 + CDS Synonymous[Ala367Ala]
1176 .. 1176 G/A rs146365513 + CDS Nonsynonymous[Gly370Ser]
1226 .. 1226 C/T rs142698314 + CDS Synonymous[Ser386Ser]
1331 .. 1331 C/T rs140653864 + CDS Synonymous[Ser421Ser]
1366 .. 1366 T/G rs17853048 + CDS Nonsynonymous[Leu433Trp]
1420 ^ 1421 -/G rs143974514 + CDS
1438 .. 1438 G/A rs36082642 - CDS Nonsynonymous[Gly457Asp]
1439 .. 1439 C/G rs144312496 + CDS Synonymous[Gly457Gly]
1445 .. 1445 G/A rs201946541 + CDS Synonymous[Thr459Thr]
1469 .. 1469 T/C rs199713405 + CDS Synonymous[Tyr467Tyr]
1545 .. 1545 A/G rs61758454 + CDS Nonsynonymous[Ile493Val]
1562 .. 1562 C/T rs150607951 + CDS Synonymous[Cys498Cys]
1634 .. 1634 C/T rs139681555 + CDS Synonymous[Ala522Ala]
1646 .. 1646 C/T rs189465517 + CDS Synonymous[His526His]
1699 .. 1699 C/T rs201330662 + CDS Nonsynonymous[Pro544Leu]
1713 .. 1713 C/T rs180815441 + CDS Nonsynonymous[Pro549Ser]
1999 .. 1999 T/C rs200811835 + CDS Nonsynonymous[Leu644Pro]
2015 .. 2015 A/C rs149781565 + CDS Synonymous[Thr649Thr]
2143 .. 2143 C/T rs201792550 + CDS Nonsynonymous[Pro692Leu]
2163 .. 2163 C/A rs145617523 + CDS Nonsynonymous[Gln699Lys]
2250 .. 2250 C/T rs201130951 + 3'UTR
2269 .. 2269 T/C rs201563126 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
L1MEg 2311 2415 +
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer