H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000041549 Accession number: BC032459 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Segment polarity protein dishevelled homolog DVL-3; Dishevelled-3; DSH homolog 3;
 
 

Motif information
ORF

length(716),orf(69:2219)
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMD
DDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELP
PPMERTGGIGDSRPPSFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRD
GPEHATRLNGTAKGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSR
FSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITDSTMSLNIITV
TLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRS
EPIRPIDPAAWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTER
LDDFHLSIHSDMAAIVKAMASPESGLEVRDRMLLKITIPNAFIGSDVVDW
LYHNVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQCYYIFGDLCGN
MANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQYPPPPHPYNPH
PGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLASSLRSHHTH
PSYGPPGVPPLYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQS
FRMAMGNPSEFFVDVM*
a.a.
length
InterPro Name
length(716), motif(1:716) 716 IPR015506 Dishevelled-related protein [Family]
length(716), motif(1:716) 716 IPR008342 Dishevelled-3 [Family]
length(82), motif(1:82) 82 IPR001158 DIX domain [Domain]
length(79), motif(2:80) 79 IPR029071 Ubiquitin-related domain [Domain]
length(80), motif(2:81) 80 IPR001158 DIX domain [Domain]
length(72), motif(142:213) 72 IPR003351 Dishevelled protein domain [Domain]
length(115), motif(227:341) 115 IPR001478 PDZ domain [Domain]
length(111), motif(228:338) 111 IPR001478 PDZ domain [Domain]
length(73), motif(249:321) 73 IPR001478 PDZ domain [Domain]
length(84), motif(250:333) 84 IPR001478 PDZ domain [Domain]
length(80), motif(258:337) 80 IPR001478 PDZ domain [Domain]
length(15), motif(324:338) 15 IPR008339 Dishevelled family [Family]
length(13), motif(358:370) 13 IPR008339 Dishevelled family [Family]
length(99), motif(397:495) 99 IPR011991 Winged helix-turn-helix DNA-binding domain [Domain]
length(75), motif(422:496) 75 IPR000591 DEP domain [Domain]
length(70), motif(425:494) 70 IPR000591 DEP domain [Domain]
length(11), motif(453:463) 11 IPR008339 Dishevelled family [Family]
length(12), motif(479:490) 12 IPR008339 Dishevelled family [Family]
length(11), motif(499:509) 11 IPR008342 Dishevelled-3 [Family]
length(207), motif(500:706) 207 IPR024580 Dishevelled C-terminal [Domain]
length(10), motif(551:560) 10 IPR008342 Dishevelled-3 [Family]
length(12), motif(585:596) 12 IPR008342 Dishevelled-3 [Family]
length(12), motif(634:645) 12 IPR008342 Dishevelled-3 [Family]