H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000047653 Accession number: AK127780 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Protein SDE2 homolog.
 
 

Motif information
ORF

length(439),orf(20:1339)
MAEAAALVWIRGPGFGCKAVRCASGRCTVRDFIHRHCQDQNVPVENFFVK
CNGAVYSLEPRLCGGKGGFGSMLRALGAQIEKTTNREACRDLSGRRLRDV
NHEKAMAEWVKQQAEREAEKEQKRLERLQRKLVEPKHCFTSPDYQQQCHG
MAERLEDSVLKGMQAASSKMVSAEISENRKRQWPTKSQTDRGASAGKRRC
FWLGMEGLETAEGSNSESSDDDSEEAPSTSGMGFHAPKIGSNGVEMAAKF
PSGSQRARVVNTDHGSPEQLQIPVTDSGRHILEDSCAELGESKEHMESRM
VTETEETQEKKAESKEPIEEEPTGAGLNKDKETEERTDGERVAEVAPEER
ENVAVAKLQESQPGNAVIDKETIDLLAFTSVAELELLGLEKLKCELMALG
LKCGGTLQERAARLFSVRGLAKEQIDPALFAKPLKGKKK*
a.a.
length
InterPro Name
length(79), motif(55:133) 79 IPR024974 Sde2 N-terminal domain [Domain]