H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000050447 Accession number: BC004923 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to GTP-binding protein 10 isoform 1.
 
 

Transcript original information
Accession number BC004923.2
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:3605104
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (GTPBP10) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (GTPBP10);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 1218[bp] (No. of exon:9)[A:460 T:314 G:246 C:198]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Uterus, endometrium adenocarcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N-truncated
Kozak sequence NA
PolyA Site: 1163(+) Signal: 1143-1147(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) AAGGAG; 
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0217925
Genomic location  G-integra Help Chromosome 7
Location 7q21.13
Position 89982127- 90014493
Strand +
Possible duplicated location(s) NA
Gene structure 9 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:85865
KEGG GENES KEGG GENES(85865)
GeneCard GeneCardGTPBP10*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000124763
Predicted CDS 2..1138;  378[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.662

Motif information
ORF

length(378),orf(2:1138)
RKYGNFIDKLRLFTRGGSGGMGYPRLGGEGGKGGDVWVVAQNRMTLKQLK
DRYPRKRFVAGVGANSKISALKGSKGKDWEIPVPVGISVTDENGKIIGEL
SKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNA
GKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYSDFKQISVADLPGLIEG
AHMNKGMGHKFLKHIERTRQLLFVVDISGFQLSSHTQYRTAFETIILLTK
ELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFLHLFEKN
MIPERTVEFQHIIPISAVTGEGIEELKNCIRKSLDEQANQENDALHKKQL
LNLWISDTMSSTEPPSKHAVTTSKMDII*
a.a.
length
InterPro Name
length(134), motif(5:138) 134 IPR006169 GTP1/OBG domain [Domain]
length(117), motif(6:122) 117 IPR006169 GTP1/OBG domain [Domain]
length(95), motif(26:120) 95 IPR006169 GTP1/OBG domain [Domain]
length(136), motif(140:275) 136 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(202), motif(141:342) 202 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(130), motif(141:270) 130 IPR006073 GTP binding domain [Domain]
length(21), motif(142:162) 21 IPR006073 GTP binding domain [Domain]
length(19), motif(163:181) 19 IPR006073 GTP binding domain [Domain]
length(16), motif(191:206) 16 IPR006073 GTP binding domain [Domain]
length(19), motif(208:226) 19 IPR006073 GTP binding domain [Domain]
length(37), motif(309:345) 37 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000050447
H-Inv cluster ID Locus viewHIX0217925
Accession number BC004923.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to GTP-binding protein 10 isoform 1.
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (NP_001036182)  [Identity/coverage = 100.0%/97.08%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol GTPBP10
HGNC aliases NA
HGNC name GTP-binding protein 10 (putative)
DDBJ GTPBP10
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000124763
No. of interaction 4
Interaction partner(s) HIP000022816HIP000023206HIP000099519HIP000148666
BIND NA
DIP NA
MINT MINT-67205;  MINT-8079030; 
HPRD 13263; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:85865
KEGG GENES KEGG GENES(85865)
GeneCard GeneCardGTPBP10*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function GTP binding (GO:0005525); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
26 118 1lnzA1 2e-19 34.4 93/157 b.117.1.1
108 208 1z2cB1 6e-17 15.6 96/346 a.118.1.23
243 306 1g7rA4 3e-06 39.3 61/212 c.37.1.8
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsB110411; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 234311_s_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 234311_s_at; 
HG-U133_Plus_2 234311_s_at; 
HG-U95 75180_at; 
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E 75180_at; 
HG-U95Av2 NA
HuEx-1_0 3011985;  3011986;  3011987;  3011988;  3011990;  3011991;  3011993;  3011994;  3011995;  3011997;  3011998;  3011999; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P168656; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P168656; 
Related H-InvDB links H-ANGELH-ANGEL;  DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
10 .. 10 T/C rs6972561 + CDS Synonymous[Tyr3Tyr]
73 .. 73 T/C rs201815769 + CDS Synonymous[Pro24Pro]
102 .. 102 G/A rs139840397 + CDS Nonsynonymous[Gly34Asp]
138 .. 138 T/C rs149432412 + CDS Nonsynonymous[Leu46Ser]
149 .. 149 A/G rs146386249 + CDS Nonsynonymous[Lys50Glu]
164 .. 164 C/T rs139533783 + CDS Nonsynonymous[Arg55Trp]
207 .. 207 G/T rs76390138 + CDS Nonsynonymous[Ser69Ile]
208 .. 208 T/C rs201885336 + CDS Synonymous[Ser69Ser]
238 .. 238 G/T rs42663 + CDS Nonsynonymous[Trp79Cys]
249 .. 249 T/C rs201709035 + CDS Nonsynonymous[Val83Ala]
303 .. 303 G/A rs42664 + CDS Nonsynonymous[Ser101Asn]
311 .. 311 A/G rs1978067 + CDS Nonsynonymous[Asn104Asp]
405 .. 405 A/G rs186591323 + CDS Nonsynonymous[Asp135Gly]
409 .. 409 A/C rs112502888 + CDS Synonymous[Leu136Leu]
459 .. 459 C/A rs188149177 + CDS Nonsynonymous[Ser153Tyr]
466 .. 466 G/C rs35001814 - CDS Nonsynonymous[Leu155Phe]
484 .. 484 T/C rs150172644 + CDS Synonymous[His161His]
491 .. 491 C/A rs147840858 + CDS Nonsynonymous[Pro164Thr]
508 .. 508 C/T rs147478564 + CDS Synonymous[Tyr169Tyr]
551 .. 551 A/T rs17867481 + CDS Nonsynonymous[Ser184Cys]
569 .. 569 T/C rs189384067 + CDS Nonsynonymous[Ser190Pro]
585 .. 585 C/T rs111685426 + CDS Nonsynonymous[Pro195Leu]
625 .. 625 C/A rs17865175 + CDS Synonymous[Gly208Gly]
645 .. 645 T/C rs149486407 + CDS Nonsynonymous[Ile215Thr]
786 .. 786 A/G rs17865585 + CDS Nonsynonymous[Lys262Arg]
867 .. 867 A/C rs148144017 + CDS Nonsynonymous[Asn289Thr]
1050 .. 1050 T/A rs201866556 + CDS AA-STOP[Leu350*]
1078 .. 1078 G/A rs17863999 + CDS Nonsynonymous[Met359Ile]
1139 .. 1139 A/G rs148357215 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer