H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000050447 Accession number: BC004923 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to GTP-binding protein 10 isoform 1.
 
 

Motif information
ORF

length(378),orf(2:1138)
RKYGNFIDKLRLFTRGGSGGMGYPRLGGEGGKGGDVWVVAQNRMTLKQLK
DRYPRKRFVAGVGANSKISALKGSKGKDWEIPVPVGISVTDENGKIIGEL
SKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNA
GKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYSDFKQISVADLPGLIEG
AHMNKGMGHKFLKHIERTRQLLFVVDISGFQLSSHTQYRTAFETIILLTK
ELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFLHLFEKN
MIPERTVEFQHIIPISAVTGEGIEELKNCIRKSLDEQANQENDALHKKQL
LNLWISDTMSSTEPPSKHAVTTSKMDII*
a.a.
length
InterPro Name
length(134), motif(5:138) 134 IPR006169 GTP1/OBG domain [Domain]
length(117), motif(6:122) 117 IPR006169 GTP1/OBG domain [Domain]
length(95), motif(26:120) 95 IPR006169 GTP1/OBG domain [Domain]
length(136), motif(140:275) 136 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(202), motif(141:342) 202 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(130), motif(141:270) 130 IPR006073 GTP binding domain [Domain]
length(21), motif(142:162) 21 IPR006073 GTP binding domain [Domain]
length(19), motif(163:181) 19 IPR006073 GTP binding domain [Domain]
length(16), motif(191:206) 16 IPR006073 GTP binding domain [Domain]
length(19), motif(208:226) 19 IPR006073 GTP binding domain [Domain]
length(37), motif(309:345) 37 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]