H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000050700 Accession number: BC018149 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Interleukin-15; IL-15; Precursor;
 
 

Transcript original information
Accession number BC018149.2
CAGE tag ID NA
EST ID NA
Clone Number MGC:9721 IMAGE:3851514
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (IL15) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (IL15);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 1968[bp] (No. of exon:8)[A:537 T:549 G:452 C:430]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Colon, adenocarcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1944(+) Signal: 1934-1938(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0024550
Genomic location  G-integra Help Chromosome 4
Location 4q31.21
Position 142557755- 142654612
Strand +
Possible duplicated location(s) NA
Gene structure 8 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3600
KEGG GENES KEGG GENES(3600)
GeneCard GeneCardIL15*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000092266
Predicted CDS 845..1333;  162[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.661
Database links RefSeq NP_000576
UniProt P40933
CCDS CCDS3755

Motif information
ORF

length(162),orf(845:1333)
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANW
VNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISL
ESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQS
FVHIVQMFINTS*
a.a.
length
InterPro Name
length(18), motif(1:18) 18 IPR020466 Interleukin-15, mammal [Family]
length(26), motif(24:49) 26 IPR020466 Interleukin-15, mammal [Family]
length(128), motif(33:160) 128 IPR003443 Interleukin-15/Interleukin-21 family [Family]
length(113), motif(49:161) 113 IPR009079 Four-helical cytokine-like, core [Domain]
length(12), motif(59:70) 12 IPR020466 Interleukin-15, mammal [Family]
length(12), motif(70:81) 12 IPR020439 Interleukin-15 [Family]
length(19), motif(83:101) 19 IPR020439 Interleukin-15 [Family]
length(14), motif(135:148) 14 IPR020439 Interleukin-15 [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000050700
H-Inv cluster ID Locus viewHIX0024550
Accession number BC018149.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Interleukin-15; IL-15; Precursor;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P40933)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 817815586683458932977940563215489334ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol IL15
HGNC aliases NA
HGNC name interleukin 15
DDBJ IL15
UniProt IL15
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000092266
No. of interaction 3
Interaction partner(s) HIP000043942HIP000043942HIP000090502
BIND NA
DIP 4304E;  4420E;  4422E; 
MINT NA
HPRD 00896;  02391; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3600
KEGG GENES KEGG GENES(3600)
GeneCard GeneCardIL15*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function hematopoietin/interferon-class (D200-domain) cytokine receptor binding (GO:0005126); 
Biological process immune response (GO:0006955); 
Cellular component extracellular region (GO:0005576); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT extracellular;  lysosome;  mitochondria;  peroxisome; 
Target P signal peptide
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
49 162 2psmA1 4e-42 57.9 114/114 a.26.1.2
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA220812; 
Affymetrix
GeneChip
HG-Focus 205992_s_at; 
HG-U133 205992_s_at;  217371_s_at; 
HG-U133A 205992_s_at;  217371_s_at; 
HG-U133A_2 205992_s_at;  217371_s_at; 
HG-U133B NA
HG-U133_Plus_2 205992_s_at;  217371_s_at; 
HG-U95 1036_at;  38488_s_at; 
HG-U95A 1036_at;  38488_s_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2745291;  2745292;  2745293;  2745294;  2745296;  2745313;  2745314;  2745320;  2745322;  2745323;  2745324;  2745325;  2787429; 
HuGeneFL U14407_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P29953; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P29953; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
252 .. 252 G/T rs191765115 + 5'UTR
264 .. 264 T/C rs182100460 + 5'UTR
341 .. 341 A/C rs148179017 + 5'UTR
352 .. 352 T/C rs186612424 + 5'UTR
364 .. 364 A/C rs191403796 + 5'UTR
420 .. 420 G/C rs142003119 + 5'UTR
482 .. 482 C/G rs185685749 + 5'UTR
618 .. 618 G/T rs150622865 + 5'UTR
633 .. 633 C/A rs141293383 + 5'UTR
744 .. 744 G/A rs182459184 + 5'UTR
765 .. 765 C/T rs2254514 + 5'UTR
791 .. 791 C/G rs187453268 + 5'UTR
831 .. 831 C/T rs114965899 + 5'UTR
856 .. 856 G/A rs139120184 + CDS Synonymous[Ser4Ser]
893 .. 893 T/A rs35221404 - CDS Nonsynonymous[Leu17Met]
952 ^ 953 -/G rs55876045 + CDS
993 .. 993 G/T rs200531127 + CDS Nonsynonymous[Trp50Leu]
1068 .. 1068 C/T rs144093178 + CDS Nonsynonymous[Thr75Met]
1069 .. 1069 G/A rs143236056 + CDS Synonymous[Thr75Thr]
1074 .. 1074 G/A rs148183667 + CDS Nonsynonymous[Ser77Asn]
1108 .. 1108 G/T rs116748569 + CDS Nonsynonymous[Met88Ile]
1151 .. 1151 G/A rs115489196 + CDS Nonsynonymous[Gly103Arg]
1193 .. 1193 C/T rs116501276 + CDS Synonymous[Leu117Leu]
1196 .. 1196 G/A rs143498316 + CDS Nonsynonymous[Ala118Thr]
1252 .. 1252 T/C rs145684493 + CDS Synonymous[Cys136Cys]
1319 .. 1319 A/G rs114174444 + CDS Nonsynonymous[Ile159Val]
1323 .. 1323 A/C rs189318312 + CDS Nonsynonymous[Asn160Thr]
1335 .. 1335 T/A/C rs113709793 + 3'UTR
1370 .. 1370 A/G rs200486307 + 3'UTR
1405 .. 1405 A/C rs55981819 + 3'UTR
1411 .. 1411 C/A rs56254924 + 3'UTR
1416 .. 1416 C/A rs10519613 + 3'UTR
1560 .. 1560 T/A rs187414414 + 3'UTR
1602 .. 1602 A/T rs56245420 + 3'UTR
1676 .. 1676 A/G rs190059240 + 3'UTR
1764 .. 1764 T/A rs1057972 + 3'UTR
1850 .. 1850 G/T rs9282743 + 3'UTR
1879 .. 1879 C/T rs10833 - 3'UTR
1922 .. 1922 T/A rs9282744 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer