H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000051353 Accession number: BC035234 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Ankyrin repeat domain-containing protein 53 isoform b.
 
 

Motif information
ORF

length(343),orf(202:1233)
MASAGSTARRAGSGSWHSERGEGRGARPQPTPSGSMQQANKVSLKATWTD
AESKQPSQPLPDLADHLSAQATALARPRRPASLTPPRADPSPSKESDQTA
IDQTAIGSYYQLFAAAVGNVEWLRFCLNQSLREIPTDDKGFTAIHFAAQW
GKIACLQVLVEEYKFPVDLLTNNSQTPLHLVIHRDNTTVALPCIYYLLEK
GADLNAQTCNGSTPLHLAARDGLLDCVKVLVQSGANVHAQDAMGYKPIDF
CKIWNHRACARFLKDAMWKKDKKDFAREMTKMKMFKSQLTLMEHNYLIEY
QGQGCSVHFPFAFSPITPETLLWQDISLLSDCGFLWRRRELSF*
a.a.
length
InterPro Name
length(158), motif(106:263) 158 IPR020683 Ankyrin repeat-containing domain [Domain]
length(164), motif(113:276) 164 IPR020683 Ankyrin repeat-containing domain [Domain]
length(31), motif(139:169) 31 IPR002110 Ankyrin repeat [Repeat]
length(136), motif(140:275) 136 IPR020683 Ankyrin repeat-containing domain [Domain]
length(16), motif(140:155) 16 IPR002110 Ankyrin repeat [Repeat]
length(34), motif(173:206) 34 IPR002110 Ankyrin repeat [Repeat]
length(37), motif(173:209) 37 IPR002110 Ankyrin repeat [Repeat]
length(89), motif(178:266) 89 IPR020683 Ankyrin repeat-containing domain [Domain]
length(15), motif(193:207) 15 IPR002110 Ankyrin repeat [Repeat]
length(30), motif(210:239) 30 IPR002110 Ankyrin repeat [Repeat]
length(33), motif(210:242) 33 IPR002110 Ankyrin repeat [Repeat]