H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000051463 Accession number: BC035665 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Heat shock 70 kDa protein 6; Heat shock 70 kDa protein B';
 
 

Transcript original information
Accession number BC035665.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:46216 IMAGE:5723718
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (HSPA6) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (HSPA6);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 2279[bp] (No. of exon:1)[A:528 T:403 G:711 C:637]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Ovary, pooled from 3 adults
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 2241(+) Signal: 2233-2237(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0213770
Genomic location  G-integra Help Chromosome 1
Location 1q23.3
Position 161494340- 161496580
Strand +
Possible duplicated location(s) NA
Gene structure 1 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3310
KEGG GENES KEGG GENES(3310)
GeneCard GeneCardHSPA6*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000087955
Predicted CDS 110..2041;  643[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.845
Database links RefSeq NP_002146
UniProt P17066
CCDS CCDS1231

Motif information
ORF

length(643),orf(110:2041)
MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTE
RLVGDAAKSQAALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEG
GKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVPA
YFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIF
DLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRK
HGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSIT
RARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQK
LLQDFFNGKELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAP
LSLGLETAGGVMTTLIQRNATIPTKQTQTFTTYSDNQPGVFIQVYEGERA
MTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSVTATDRSTGKA
NKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFH
VKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRE
LEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD*
a.a.
length
InterPro Name
length(14), motif(7:20) 14 IPR013126 Heat shock protein 70 family [Family]
length(606), motif(8:613) 606 IPR013126 Heat shock protein 70 family [Family]
length(8), motif(11:18) 8 IPR018181 Heat shock protein 70, conserved site [Conserved_site]
length(13), motif(35:47) 13 IPR013126 Heat shock protein 70 family [Family]
length(9), motif(57:65) 9 IPR013126 Heat shock protein 70 family [Family]
length(21), motif(144:164) 21 IPR013126 Heat shock protein 70 family [Family]
length(14), motif(199:212) 14 IPR018181 Heat shock protein 70, conserved site [Conserved_site]
length(11), motif(205:215) 11 IPR013126 Heat shock protein 70 family [Family]
length(17), motif(333:349) 17 IPR013126 Heat shock protein 70 family [Family]
length(15), motif(336:350) 15 IPR018181 Heat shock protein 70, conserved site [Conserved_site]
length(21), motif(365:385) 21 IPR013126 Heat shock protein 70 family [Family]
length(158), motif(388:545) 158 IPR029047 Heat shock protein 70kD, peptide-binding domain [Domain]
length(20), motif(392:411) 20 IPR013126 Heat shock protein 70 family [Family]
length(127), motif(394:520) 127 IPR029047 Heat shock protein 70kD, peptide-binding domain [Domain]
length(17), motif(473:489) 17 IPR013126 Heat shock protein 70 family [Family]
length(101), motif(521:621) 101 IPR029048 Heat shock protein 70kD, C-terminal domain [Domain]
length(82), motif(540:621) 82 IPR029048 Heat shock protein 70kD, C-terminal domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000051463
H-Inv cluster ID Locus viewHIX0213770
Accession number BC035665.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript; 
Coding potential  Help Protein coding; 
Definition Heat shock 70 kDa protein 6; Heat shock 70 kDa protein B';
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P17066)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 1346391232797831841911548933416710414ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol HSPA6
HGNC aliases "heat shock 70kD protein 6 (HSP70B')"
HGNC name heat shock 70kDa protein 6 (HSP70B')
DDBJ HSPA6
UniProt HSPA6
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000087955
No. of interaction 23
Interaction partner(s) HIP000022138HIP000022251HIP000027819HIP000027819HIP000028809HIP000030888HIP000030888HIP000031403HIP000031403HIP000031586HIP000034328HIP000034328HIP000035708HIP000045275HIP000045286HIP000068392HIP000070499HIP000072479HIP000072479HIP000086898HIP000107309HIP000247082HIP000354287
BIND NA
DIP 145030E;  180168E; 
MINT MINT-1785982;  MINT-48155;  MINT-48290;  MINT-48405;  MINT-48577;  MINT-48649;  MINT-48803;  MINT-48987;  MINT-49059;  MINT-49165;  MINT-49309;  MINT-49390;  MINT-7947479; 
HPRD 01238;  01239;  01286;  01861;  01862;  03144;  03897;  03965;  04184;  04585;  05230;  05496;  06232;  06886;  06888;  07486;  07601;  14358;  16246;  19599; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3310
KEGG GENES KEGG GENES(3310)
GeneCard GeneCardHSPA6*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA


Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear;  peroxisome; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
5 190 1atrA1 3e-21 80.6 186/187 c.55.1.1
193 386 1atrA2 2e-53 79.4 194/196 c.55.1.1
406 545 3c7nB1 1e-53 77.9 140/154 b.130.1.1
540 613 1ud0A 3e-27 47.3 74/84 a.8.4.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA241418; 
Affymetrix
GeneChip
HG-Focus 117_at; 
HG-U133 117_at;  213418_at; 
HG-U133A 117_at;  213418_at; 
HG-U133A_2 117_at;  213418_at; 
HG-U133B NA
HG-U133_Plus_2 117_at;  213418_at; 
HG-U95 117_at;  35965_at;  56711_s_at; 
HG-U95A 117_at;  35965_at; 
HG-U95B NA
HG-U95C 56711_s_at; 
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2363785;  2363786;  2363787;  2363788;  2363789;  2363791;  2363792;  2363793;  2363794;  2363795;  2363796;  2440940; 
HuGeneFL X51757_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P114903; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P114903; 
Related H-InvDB links H-ANGELH-ANGEL;  DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
10 .. 10 T/G rs425949 - 5'UTR
18 .. 18 A/C rs41297690 + 5'UTR
89 .. 89 A/T rs41297692 + 5'UTR
102 .. 102 C/T rs41297694 + 5'UTR
109 .. 109 C/T rs41297696 + 5'UTR
256 .. 256 C/G rs3754052 - CDS Synonymous[Thr49Thr]
302 .. 302 C/A rs41297698 + CDS Nonsynonymous[Pro65Thr]
339 .. 339 G/C rs150647842 + CDS Nonsynonymous[Gly77Ala]
383 .. 383 T/G rs143602691 + CDS Nonsynonymous[Trp92Gly]
392 .. 392 C/G rs201325536 + CDS Nonsynonymous[Arg95Gly]
393 .. 393 G/A rs400835 + CDS Nonsynonymous[Arg95Gln]
403 .. 403 C/G rs199752876 + CDS Nonsynonymous[Ser98Arg]
422 .. 422 G/T rs140716677 + CDS Nonsynonymous[Val105Leu]
430 .. 430 A/G rs145333180 + CDS Synonymous[Val107Val]
454 .. 454 G/A rs201874695 + CDS Synonymous[Thr115Thr]
557 .. 557 G/A rs10919224 + CDS Nonsynonymous[Ala150Thr]
567 .. 567 A/G rs10919225 + CDS Nonsynonymous[Asn153Ser]
569 .. 569 G/A rs10919226 + CDS Nonsynonymous[Asp154Asn]
578 .. 578 C/A rs142879773 + CDS Nonsynonymous[Arg157Ser]
585 .. 585 C/T rs41297702 + CDS Nonsynonymous[Ala159Val]
588 .. 588 C/T rs138021734 + CDS Nonsynonymous[Thr160Ile]
619 .. 619 C/G rs41297704 + CDS Nonsynonymous[Asn170Lys]
623 .. 623 T/C rs41297706 + CDS Synonymous[Leu172Leu]
627 .. 627 G/C rs41297708 + CDS Nonsynonymous[Arg173Pro]
634 .. 634 C/T rs144265854 + CDS Synonymous[Ile175Ile]
641 .. 641 C/G rs41297710 + CDS Nonsynonymous[Pro178Ala]
652 .. 652 T/A rs41297712 + CDS Synonymous[Ala181Ala]
684 .. 684 C/G rs28716417 + CDS Nonsynonymous[Ala192Gly]
689 .. 689 G/A rs41297714 + CDS Nonsynonymous[Glu194Lys]
698 .. 698 G/A rs139552185 + CDS Nonsynonymous[Val197Met]
701 .. 701 C/T rs63749092 + CDS Nonsynonymous[Leu198Phe]
701 .. 701 C/T rs1079109 + CDS Nonsynonymous[Leu198Phe]
726 .. 726 C/T rs149827217 + CDS Nonsynonymous[Thr206Ile]
745 .. 745 C/G rs142060516 + CDS Synonymous[Leu212Leu]
778 .. 778 C/T rs41297716 + CDS Synonymous[Ala223Ala]
809 .. 809 G/A rs147002100 + CDS Nonsynonymous[Asp234Asn]
915 .. 915 G/A rs141711758 + CDS Nonsynonymous[Cys269Tyr]
921 .. 921 G/A rs138613886 + CDS Nonsynonymous[Arg271His]
936 .. 936 T/C rs200790521 + CDS Nonsynonymous[Leu276Pro]
958 .. 958 C/T rs146341078 + CDS Synonymous[Thr283Thr]
965 .. 965 A/C rs142781522 + CDS Nonsynonymous[Ile286Leu]
999 .. 999 C/A rs41297718 + CDS Nonsynonymous[Thr297Lys]
1008 .. 1008 C/T rs148797832 + CDS Nonsynonymous[Thr300Ile]
1028 .. 1028 C/T rs151297860 + CDS Synonymous[Leu307Leu]
1033 .. 1033 C/T rs55898103 + CDS Synonymous[Cys308Cys]
1080 .. 1080 G/A rs144281379 + CDS Nonsynonymous[Arg324Gln]
1090 .. 1090 G/A rs141086137 + CDS Synonymous[Lys327Lys]
1115 .. 1115 G/T rs417707 - CDS Nonsynonymous[Val336Phe]
1124 .. 1124 G/A rs142859332 + CDS Nonsynonymous[Val339Met]
1128 .. 1128 G/A rs12119062 + CDS Nonsynonymous[Gly340Glu]
1129 .. 1129 G/A rs143204924 + CDS Synonymous[Gly340Gly]
1130 .. 1130 G/A rs141771248 + CDS Nonsynonymous[Gly341Ser]
1131 .. 1131 G/A rs138329594 + CDS Nonsynonymous[Gly341Asp]
1138 .. 1138 T/A rs72633678 + CDS Synonymous[Thr343Thr]
1138 .. 1138 T/A rs17853454 + CDS Synonymous[Thr343Thr]
1158 .. 1158 A/G rs144853604 + CDS Nonsynonymous[Lys350Arg]
1181 .. 1181 G/A rs200985857 + CDS Nonsynonymous[Gly358Ser]
1232 .. 1232 G/T rs140052915 + CDS Nonsynonymous[Ala375Ser]
1232 .. 1232 G/T rs9659608 + CDS Nonsynonymous[Ala375Ser]
1353 .. 1353 T/C rs139557364 + CDS Nonsynonymous[Leu415Pro]
1360 .. 1360 G/C rs150927976 + CDS Nonsynonymous[Gln417His]
1396 .. 1396 T/G rs41297720 + CDS Synonymous[Thr429Thr]
1410 .. 1410 C/T rs200111192 + CDS Nonsynonymous[Ser434Leu]
1418 .. 1418 C/T rs140320557 + CDS AA-STOP[Gln437*]
1427 .. 1427 G/A rs11577457 + CDS Nonsynonymous[Val440Ile]
1443 .. 1443 A/G rs145456895 + CDS Nonsynonymous[Tyr445Cys]
1449 .. 1449 G/T rs56366425 + CDS Nonsynonymous[Gly447Val]
1449 .. 1449 G/T rs450363 + CDS Nonsynonymous[Gly447Val]
1484 .. 1484 G/A rs200236588 + CDS Nonsynonymous[Gly459Arg]
1500 .. 1500 G/T rs388218 - CDS Nonsynonymous[Ser464Ile]
1504 .. 1504 C/A rs141425292 + CDS Synonymous[Gly465Gly]
1518 .. 1518 C/T rs185517137 + CDS Nonsynonymous[Pro470Leu]
1521 .. 1521 G/A rs41299256 + CDS Nonsynonymous[Arg471His]
1546 .. 1546 C/T/G rs404508 - CDS
1572 .. 1572 T/C rs147297153 + CDS Nonsynonymous[Leu488Pro]
1590 .. 1590 A/T rs200558605 + CDS Nonsynonymous[Asp494Val]
1610 .. 1610 A/G rs143965374 + CDS Nonsynonymous[Asn501Asp]
1638 .. 1638 G/A rs148603479 + CDS Nonsynonymous[Gly510Asp]
1671 .. 1671 T/G rs199677197 + CDS Nonsynonymous[Val521Gly]
1691 .. 1691 A/G rs79983347 + CDS Nonsynonymous[Lys528Glu]
1691 .. 1691 A/G rs570189 - CDS Nonsynonymous[Lys528Glu]
1692 .. 1692 A/G rs570167 - CDS Nonsynonymous[Lys528Arg]
1700 .. 1700 G/C rs200404972 + CDS Nonsynonymous[Asp531His]
1703 .. 1703 G/A rs3820450 - CDS Nonsynonymous[Glu532Lys]
1714 .. 1714 G/A rs140399106 + CDS Synonymous[Arg535Arg]
1795 .. 1795 C/G rs753856 - CDS Nonsynonymous[Asp562Glu]
1817 .. 1817 C/T rs140843448 + CDS Nonsynonymous[Arg570Cys]
1823 .. 1823 A/G rs452004 - CDS Nonsynonymous[Met572Val]
1838 .. 1838 C/T rs189929972 + CDS Nonsynonymous[Arg577Trp]
1839 .. 1839 G/A rs368844 - CDS Nonsynonymous[Arg577Gln]
1959 .. 1959 G/C rs138819450 + CDS Nonsynonymous[Gly617Ala]
1978 .. 1978 T/C rs138336769 + CDS Synonymous[Ser623Ser]
1982 .. 1982 G/A rs439078 - CDS Nonsynonymous[Gly625Ser]
1985 .. 1985 A/G rs41299260 + CDS Nonsynonymous[Thr626Ala]
1995 .. 1995 G/A rs52798304 + CDS Nonsynonymous[Arg629His]
2025 .. 2025 T/C rs199535758 + CDS Nonsynonymous[Ile639Thr]
2030 .. 2030 G/A rs144080022 + CDS Nonsynonymous[Glu641Lys]
2098 .. 2098 G/T rs12562680 + 3'UTR
2132 ^ 2133 -/GGG rs60372173 + 3'UTR
2135 ^ 2136 -/GGGGGGGTCT rs60515741 + 3'UTR
2160 .. 2160 C/T rs12073773 + 3'UTR
2190 .. 2190 G/C rs41299262 + 3'UTR
2191 .. 2191 G/C rs1042881 - 3'UTR
2192 .. 2192 G/A rs41299264 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer