H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000051463 Accession number: BC035665 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Heat shock 70 kDa protein 6; Heat shock 70 kDa protein B';
 
 

Motif information
ORF

length(643),orf(110:2041)
MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTE
RLVGDAAKSQAALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEG
GKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVPA
YFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIF
DLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRK
HGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSIT
RARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQK
LLQDFFNGKELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAP
LSLGLETAGGVMTTLIQRNATIPTKQTQTFTTYSDNQPGVFIQVYEGERA
MTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSVTATDRSTGKA
NKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFH
VKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRE
LEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD*
a.a.
length
InterPro Name
length(14), motif(7:20) 14 IPR013126 Heat shock protein 70 family [Family]
length(606), motif(8:613) 606 IPR013126 Heat shock protein 70 family [Family]
length(8), motif(11:18) 8 IPR018181 Heat shock protein 70, conserved site [Conserved_site]
length(13), motif(35:47) 13 IPR013126 Heat shock protein 70 family [Family]
length(9), motif(57:65) 9 IPR013126 Heat shock protein 70 family [Family]
length(21), motif(144:164) 21 IPR013126 Heat shock protein 70 family [Family]
length(14), motif(199:212) 14 IPR018181 Heat shock protein 70, conserved site [Conserved_site]
length(11), motif(205:215) 11 IPR013126 Heat shock protein 70 family [Family]
length(17), motif(333:349) 17 IPR013126 Heat shock protein 70 family [Family]
length(15), motif(336:350) 15 IPR018181 Heat shock protein 70, conserved site [Conserved_site]
length(21), motif(365:385) 21 IPR013126 Heat shock protein 70 family [Family]
length(158), motif(388:545) 158 IPR029047 Heat shock protein 70kD, peptide-binding domain [Domain]
length(20), motif(392:411) 20 IPR013126 Heat shock protein 70 family [Family]
length(127), motif(394:520) 127 IPR029047 Heat shock protein 70kD, peptide-binding domain [Domain]
length(17), motif(473:489) 17 IPR013126 Heat shock protein 70 family [Family]
length(101), motif(521:621) 101 IPR029048 Heat shock protein 70kD, C-terminal domain [Domain]
length(82), motif(540:621) 82 IPR029048 Heat shock protein 70kD, C-terminal domain [Domain]