H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000051794 Accession number: BC036754 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Claudin-12;
 
 

Motif information
ORF

length(244),orf(129:863)
MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTV
YTGLWVKCARYDGSSDCLMYDTTWYSSVDQLDLRVLQFALPLSMLIAMGA
LLLCLIGMCNTAFRSSVPNIKLAKCLVNSAGCHLVAGLLFFLAGTVSLSP
SIWVIFYNIHLNKKFEPVFSFDYAVYVTIASAGGLFMTSLILFIWYCTCK
SLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT*
a.a.
length
InterPro Name
length(16), motif(38:53) 16 IPR013287 Claudin-12 [Family]
length(15), motif(53:67) 15 IPR017974 Claudin, conserved site [Conserved_site]
length(17), motif(65:81) 17 IPR013287 Claudin-12 [Family]
length(13), motif(123:135) 13 IPR013287 Claudin-12 [Family]
length(12), motif(150:161) 12 IPR013287 Claudin-12 [Family]