H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000051821 Accession number: BC036809 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Rho guanine nucleotide exchange factor 10;
 
 

Transcript original information
Accession number BC036809.1
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:5737598
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 3483[bp] (No. of exon:15)[A:970 T:865 G:833 C:815]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Duodenum, adenocarcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 3469(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGAAG;  CAGCAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0021591
Genomic location  G-integra Help Chromosome 8
Location 8p23.3
Position 1824217- 1875669
Strand +
Possible duplicated location(s) NA
Gene structure 15 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:9639
KEGG GENES KEGG GENES(9639)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000063267
Predicted CDS 522..2504;  660[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.748

Motif information
ORF

length(660),orf(522:2504)
MHSDEMIYDDVENGDEGGNSSLEYGWSSSEFESYEEQSDSECKNGIPRSF
LRSNHKKQMQKLVKAAKDGTKDGLERTRAAVKRGRSFIRTKSLIAQDHRS
SLEEEQNLFIDVDCKHPEAILTPMPEGLSQQQVVRRYILGSVVDSEKNYV
DALKRILEQYEKPLSEMEPKVLSERKLKTVFYRVKEILQCHSLFQIALAS
RVSEWDSVEMIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKP
AFLEFLKQEQEASPDRTTLYSLMMKPIQRFPQFILLLQDMLKNTSKGHPD
RLPLQMALTELETLAEKLNERKRDADQRCEVKQIAKAINERYLNKLLSSG
SRYLIRSDDMIETVYNDRGEIVKTKERRVFMLNDVLMCATVSSRPSHDSR
VMSSQRYLLKWSVPLGHVDAIEYGSSAGTGEHSRHLAVHPPESLAVVANA
KPNKVYMGPGQLYQDLQNLLHDLNVIGQITQLIGNLKGNYQNLNQSVAHD
WTSGLQRLILKKEDEIRAADCCRIQLQLPGKQDKSGRPTFFTAVFNTFTP
AIKESWVNSLQMAKLALEENHMGWFCVEDDGNHIKKEKHPLLVGHMPVMV
AKQQEFKIECAAYNPEPYLNNESQPDSFSTAHGFLWVRCVYLVLVQVHRE
STFMVGVMRD*
a.a.
length
InterPro Name
length(218), motif(121:338) 218 IPR000219 Dbl homology (DH) domain [Domain]
length(216), motif(123:338) 216 IPR000219 Dbl homology (DH) domain [Domain]
length(188), motif(134:321) 188 IPR000219 Dbl homology (DH) domain [Domain]
length(183), motif(138:320) 183 IPR000219 Dbl homology (DH) domain [Domain]
length(179), motif(142:320) 179 IPR000219 Dbl homology (DH) domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000051821
H-Inv cluster ID Locus viewHIX0021591
Accession number BC036809.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Similar to Rho guanine nucleotide exchange factor 10;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (O15013)  [Identity/coverage = 99.685%/49.23%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 9205841931449412168954145087091548933416421571179740051866964821406692ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ ARHGEF10
UniProt ARHGEF10
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000063267
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:9639
KEGG GENES KEGG GENES(9639)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function Rho guanyl-nucleotide exchange factor activity (GO:0005089); 
Biological process regulation of Rho protein signal transduction (GO:0035023); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol;  golgi apparatus; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
126 334 1ki1B1 1e-35 27.0 204/210 a.87.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus NA
HG-U133 NA
HG-U133A NA
HG-U133A_2 NA
HG-U133B NA
HG-U133_Plus_2 1554213_at; 
HG-U95 NA
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3082898;  3082899;  3082901;  3082902;  3082903;  3082904;  3082908;  3082909;  3082910;  3082917;  3082919;  3082926;  3082927;  3082928;  3082929;  3082930;  3082932;  3082933;  3082934; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_24_P188085; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:27-May-2015
Disease relation Disease name: Slowed nerve conduction velocity, AD (608236); 
Related information in OMIM OMIM ID:  608136;  Title: RHO GUANINE NUCLEOTIDE EXCHANGE FACTOR 10
Co-localized orphan diseases NA
Disease related mutation MutationView:  608136
JRE-1.4.0 or later is required.Download JRE at Sun's web site.
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(9639)
Disease Entrez Gene ID:(9639)
Substance Entrez Gene ID:(9639)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
78 .. 78 T/C rs183914342 + 5'UTR
79 .. 79 A/G rs187555288 + 5'UTR
117 .. 117 A/C rs3735873 + 5'UTR
120 .. 120 G/T rs3735874 + 5'UTR
123 .. 123 A/G rs79843734 + 5'UTR
129 .. 129 G/A rs11987969 + 5'UTR
203 .. 203 C/T rs191379100 + 5'UTR
208 .. 208 G/A rs3735875 + 5'UTR
236 .. 236 G/C rs35171866 + 5'UTR
241 .. 241 G/C rs76590232 + 5'UTR
249 .. 249 C/T rs17829719 + 5'UTR
274 .. 274 C/T rs183513519 + 5'UTR
324 .. 324 T/G rs186612422 + 5'UTR
327 .. 327 C/G rs112690734 + 5'UTR
348 .. 348 G/C rs56034634 + 5'UTR
360 .. 360 C/T rs200607813 + 5'UTR
378 .. 378 A/G rs184878049 + 5'UTR
384 .. 384 C/G rs57180537 + 5'UTR
391 .. 391 G/C rs4875944 - 5'UTR
444 .. 444 A/G rs190152353 + 5'UTR
587 .. 587 G/C rs148131631 + CDS Nonsynonymous[Leu22Phe]
601 .. 601 G/T rs201446751 + CDS Nonsynonymous[Ser27Ile]
604 .. 604 C/T rs144004435 + CDS Nonsynonymous[Ser28Leu]
623 .. 623 C/A rs200052082 + CDS AA-STOP[Tyr34*]
641 .. 641 G/C rs144663694 + CDS Synonymous[Ser40Ser]
676 .. 676 G/A rs145821459 + CDS Nonsynonymous[Arg52His]
680 .. 680 C/A/T rs138769512 + CDS
697 .. 697 T/G rs199514264 + CDS Nonsynonymous[Met59Arg]
703 .. 703 A/G rs113524632 + CDS Nonsynonymous[Lys61Arg]
708 .. 708 G/A rs139046783 + CDS Nonsynonymous[Val63Met]
730 .. 730 C/T rs28940281 + CDS Nonsynonymous[Thr70Ile]
749 .. 749 G/A rs186467970 + CDS Synonymous[Arg76Arg]
761 .. 761 C/T rs200618658 + CDS Synonymous[Ala80Ala]
775 .. 775 G/A rs149632587 + CDS Nonsynonymous[Arg85His]
798 .. 798 C/G rs200109049 + CDS Nonsynonymous[Leu93Val]
827 .. 827 T/A rs201125797 + CDS Synonymous[Leu102Leu]
845 .. 845 G/C rs9657362 + CDS Nonsynonymous[Leu108Phe]
848 .. 848 C/T rs34655804 + CDS Synonymous[Phe109Phe]
875 .. 875 A/G rs147931758 + CDS Synonymous[Glu118Glu]
889 .. 889 C/T rs139937386 + CDS Nonsynonymous[Pro123Leu]
891 .. 891 A/T rs201660201 + CDS Nonsynonymous[Met124Leu]
914 .. 914 G/C rs142879329 + CDS Nonsynonymous[Gln131His]
941 .. 941 T/C rs118161222 + CDS Synonymous[Gly140Gly]
998 .. 998 A/G rs200412472 + CDS Synonymous[Gln159Gln]
1010 .. 1010 G/A rs140952059 + CDS Synonymous[Pro163Pro]
1050 .. 1050 C/G rs150372520 + CDS Nonsynonymous[Leu177Val]
1057 .. 1057 C/T rs146529284 + CDS Nonsynonymous[Thr179Met]
1066 .. 1066 A/G rs141003957 + CDS Nonsynonymous[Tyr182Cys]
1111 .. 1111 C/T rs144726787 + CDS Nonsynonymous[Ala197Val]
1112 .. 1112 G/A rs138680466 + CDS Synonymous[Ala197Ala]
1125 .. 1125 G/A rs148840693 + CDS Nonsynonymous[Val202Ile]
1128 .. 1128 T/A rs199763780 + CDS Nonsynonymous[Ser203Thr]
1131 .. 1131 G/A rs143508005 + CDS Nonsynonymous[Glu204Lys]
1142 .. 1142 C/A rs147974725 + CDS Synonymous[Ser207Ser]
1143 .. 1143 G/A rs201694611 + CDS Nonsynonymous[Val208Met]
1166 .. 1166 C/T rs3758004 + CDS Synonymous[Phe215Phe]
1174 .. 1174 C/T rs201240439 + CDS Nonsynonymous[Ser218Leu]
1263 .. 1263 A/G rs201912073 + CDS Nonsynonymous[Thr248Ala]
1271 .. 1271 C/T rs141646890 + CDS Synonymous[Pro250Pro]
1285 .. 1285 T/G rs150692591 + CDS Nonsynonymous[Phe255Cys]
1289 .. 1289 A/T rs139300291 + CDS Nonsynonymous[Leu256Phe]
1318 .. 1318 G/A rs143325951 + CDS Nonsynonymous[Arg266Gln]
1325 .. 1325 G/T rs118048417 + CDS Synonymous[Thr268Thr]
1326 .. 1326 C/A rs140110093 + CDS Nonsynonymous[Leu269Ile]
1343 .. 1343 G/T rs150004545 + CDS Nonsynonymous[Met274Ile]
1358 .. 1358 G/C rs144304948 + CDS Nonsynonymous[Arg279Ser]
1366 .. 1366 A/T rs148715187 + CDS Nonsynonymous[Gln282Leu]
1382 .. 1382 C/T rs12681485 + CDS Synonymous[Leu287Leu]
1386 .. 1386 G/A rs201067899 + CDS Nonsynonymous[Asp289Asn]
1454 .. 1454 C/T rs200136507 + CDS Synonymous[Leu311Leu]
1471 .. 1471 A/G rs146787564 + CDS Nonsynonymous[Lys317Arg]
1489 .. 1489 G/A rs1045489 + CDS Nonsynonymous[Arg323Lys]
1497 .. 1497 G/C rs201726860 + CDS Nonsynonymous[Asp326His]
1503 .. 1503 C/T rs141069028 + CDS Nonsynonymous[Arg328Cys]
1516 .. 1516 A/G rs143500957 + CDS Nonsynonymous[Lys332Arg]
1518 .. 1518 C/A rs79970226 + CDS Nonsynonymous[Gln333Lys]
1583 .. 1583 C/T rs146717173 + CDS Synonymous[Leu354Leu]
1584 .. 1584 A/G rs201123598 + CDS Nonsynonymous[Ile355Val]
1602 .. 1602 A/G rs144835192 + CDS Nonsynonymous[Ile361Val]
1605 .. 1605 G/C rs150319135 + CDS Nonsynonymous[Glu362Gln]
1633 .. 1633 T/C rs201110471 + CDS Nonsynonymous[Ile371Thr]
1641 .. 1641 A/T rs202029161 + CDS Nonsynonymous[Thr374Ser]
1653 .. 1653 C/T rs138007359 + CDS AA-STOP[Arg378*]
1691 .. 1691 C/T rs200487137 + CDS Synonymous[Thr390Thr]
1702 .. 1702 G/A rs184791801 + CDS Nonsynonymous[Arg394His]
1719 .. 1719 C/T rs149060376 + CDS Nonsynonymous[Arg400Cys]
1726 .. 1726 T/C rs34319003 + CDS Nonsynonymous[Met402Thr]
1790 .. 1790 T/C rs2294038 + CDS Synonymous[Tyr423Tyr]
1798 .. 1798 G/A rs143290224 + CDS Nonsynonymous[Ser426Asn]
1800 .. 1800 G/A rs199578912 + CDS Nonsynonymous[Ala427Thr]
1807 .. 1807 C/T rs147544189 + CDS Nonsynonymous[Thr429Met]
1808 .. 1808 G/A rs148136629 + CDS Synonymous[Thr429Thr]
1820 .. 1820 C/A rs201919004 + CDS Nonsynonymous[Ser433Arg]
1827 .. 1827 C/G rs141968995 + CDS Nonsynonymous[Leu436Val]
1832 .. 1832 C/T rs150639767 + CDS Synonymous[Ala437Ala]
1833 .. 1833 G/A rs2294039 + CDS Nonsynonymous[Val438Ile]
1838 .. 1838 C/T rs2294040 + CDS Synonymous[His439His]
1870 .. 1870 C/T rs201394769 + CDS Nonsynonymous[Ala450Val]
1871 .. 1871 G/A rs61731549 + CDS Synonymous[Ala450Ala]
1920 .. 1920 C/G rs200619686 + CDS Nonsynonymous[Gln467Glu]
1931 .. 1931 G/T rs146291427 + CDS Nonsynonymous[Leu470Phe]
1932 .. 1932 C/T rs147531758 + CDS Nonsynonymous[His471Tyr]
2077 .. 2077 C/T rs143459815 + CDS Nonsynonymous[Ala519Val]
2109 .. 2109 G/A rs146766107 + CDS Nonsynonymous[Gly530Arg]
2120 .. 2120 C/T rs34036746 + CDS Synonymous[Asp533Asp]
2175 .. 2175 A/G rs201667595 + CDS Nonsynonymous[Ile552Val]
2191 .. 2191 T/C rs200515878 + CDS Nonsynonymous[Val557Ala]
2195 .. 2195 C/G rs61758704 + CDS Nonsynonymous[Asn558Lys]
2216 .. 2216 C/T rs142592407 + CDS Synonymous[Leu565Leu]
2222 .. 2222 A/C rs199621523 + CDS Synonymous[Leu567Leu]
2225 .. 2225 G/A rs150986504 + CDS Synonymous[Glu568Glu]
2233 .. 2233 A/G rs142973221 + CDS Nonsynonymous[His571Arg]
2254 .. 2254 A/G rs145893322 + CDS Nonsynonymous[Glu578Gly]
2312 .. 2312 C/T rs2272613 - CDS Synonymous[Pro597Pro]
2315 .. 2315 G/C rs141164534 + CDS Synonymous[Val598Val]
2371 .. 2371 C/G rs147112298 + CDS Nonsynonymous[Pro617Arg]
2376 .. 2376 C/T rs138353580 + CDS Synonymous[Leu619Leu]
2381 .. 2381 T/C rs199777041 + CDS Synonymous[Asn620Asn]
2448 .. 2448 G/A rs115781544 + CDS Nonsynonymous[Val643Ile]
2517 .. 2517 T/C rs181103497 + 3'UTR
2532 .. 2532 C/T rs17064390 + 3'UTR
2540 .. 2540 T/G rs184490197 + 3'UTR
2554 .. 2554 C/G rs73671056 + 3'UTR
2615 .. 2615 C/T rs188890555 + 3'UTR
2727 .. 2727 T/C rs144488328 + 3'UTR
2794 .. 2794 G/C rs9657380 + 3'UTR
2802 .. 2802 A/C rs139230664 + 3'UTR
2851 .. 2851 G/A rs144054098 + 3'UTR
2859 .. 2859 C/T rs146410452 + 3'UTR
2884 .. 2884 G/C rs182160588 + 3'UTR
2896 .. 2896 G/T rs187199488 + 3'UTR
2916 .. 2916 C/T rs140804499 + 3'UTR
3027 .. 3027 G/A rs190862665 + 3'UTR
3038 .. 3038 T/C rs142218384 + 3'UTR
3103 .. 3103 C/T rs180729591 + 3'UTR
3108 .. 3108 T/G rs185257513 + 3'UTR
3136 .. 3136 A/G rs151232346 + 3'UTR
3189 .. 3189 T/A rs140278070 + 3'UTR
3205 .. 3205 A/G rs17064392 + 3'UTR
3222 .. 3222 C/G rs190360924 + 3'UTR
3256 .. 3256 C/T rs79724830 + 3'UTR
3431 .. 3431 G/A rs150356878 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer