H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000052101 Accession number: BC038976 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Rho GTPase-activating protein 15; ArhGAP15; Rho-type GTPase-activating protein 15;
 
 

Transcript original information
Accession number BC038976.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:47639 IMAGE:5553184
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ARHGAP15) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ARHGAP15);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 1679[bp] (No. of exon:14)[A:591 T:415 G:337 C:336]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Lymph, lymphoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1664(+) Signal: 1651-1655(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGAAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0017957
Genomic location  G-integra Help Chromosome 2
Location 2q22.2-2q22.3
Position 143887005- 144525921
Strand +
Possible duplicated location(s) NA
Gene structure 14 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:55843
KEGG GENES KEGG GENES(55843)
GeneCard GeneCardARHGAP15*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000089004
Predicted CDS 57..1484;  475[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.727
Database links RefSeq NP_060930
UniProt Q53QZ3
CCDS CCDS2184

Motif information
ORF

length(475),orf(57:1484)
MQKSTNSDTSVETLNSTRQGTGAVQMRIKNANSHHDRLSQSKSMILTDVG
KVTEPISRHRRNHSQHILKDVIPPLEQLMVEKEGYLQKAKIADGGKKLRK
NWSTSWIVLSSRRIEFYKESKQQALSNMKTGHKPESVDLCGAHIEWAKEK
SSRKNVFQITTVSGNEFLLQSDIDFIILDWFHAIKNAIDRLPKDSSCPSR
NLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNR
VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ
CIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHV
VTGALKMFFRELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLVQKLPP
PNRDTMKVLFGHLTKIVAKASKNLMSTQSLGIVFGPTLLRAENETGNMAI
HMVYQNQIAELMLSEYSKIFGSEED*
a.a.
length
InterPro Name
length(473), motif(1:473) 473 IPR015767 Rho GTPase activating protein [Family]
length(111), motif(79:189) 111 IPR001849 Pleckstrin homology domain [Domain]
length(113), motif(80:192) 113 IPR011993 Pleckstrin homology-like domain [Domain]
length(109), motif(80:188) 109 IPR001849 Pleckstrin homology domain [Domain]
length(112), motif(80:191) 112 IPR001849 Pleckstrin homology domain [Domain]
length(209), motif(263:471) 209 IPR000198 Rho GTPase-activating protein domain [Domain]
length(194), motif(277:470) 194 IPR008936 Rho GTPase activation protein [Domain]
length(190), motif(281:470) 190 IPR000198 Rho GTPase-activating protein domain [Domain]
length(176), motif(292:467) 176 IPR000198 Rho GTPase-activating protein domain [Domain]
length(150), motif(295:444) 150 IPR000198 Rho GTPase-activating protein domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000052101
H-Inv cluster ID Locus viewHIX0017957
Accession number BC038976.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Rho GTPase-activating protein 15; ArhGAP15; Rho-type GTPase-activating protein 15;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q53QZ3)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 1104215212650940154893341969033221269460ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ARHGAP15
HGNC aliases NA
HGNC name Rho GTPase activating protein 15
DDBJ ARHGAP15
UniProt ARHGAP15
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000089004
No. of interaction 1
Interaction partner(s) HIP000207868
BIND 209089; 
DIP NA
MINT MINT-19382;  MINT-19392; 
HPRD 00396;  01453;  01822;  06902; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:55843
KEGG GENES KEGG GENES(55843)
GeneCard GeneCardARHGAP15*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Biological process signal transduction (GO:0007165); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
78 193 1dynA 1e-10 12.5 112/113 b.55.1.1
277 470 1xa6A1 4e-45 32.0 194/196 a.116.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL blood/spleen/LND; 
Probe
information DNAProbeLocator
AceGene AGhsA061303; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 218870_at; 
HG-U133A 218870_at; 
HG-U133A_2 218870_at; 
HG-U133B NA
HG-U133_Plus_2 218870_at; 
HG-U95 78689_at; 
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E 78689_at; 
HG-U95Av2 NA
HuEx-1_0 2508612;  2508615;  2508620;  2508622;  2508628;  2508634;  2508675;  2508676;  2508691;  2508699;  2508706;  2508725;  2508741;  2508762;  2508763;  2508764;  2579357;  2579385; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P255166;  A_23_P84154; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P255166;  A_23_P84154; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
54 .. 54 A/G rs141361976 + 5'UTR
65 .. 65 A/G rs142436201 + CDS Synonymous[Lys3Lys]
86 .. 86 C/T rs140220849 + CDS Synonymous[Ser10Ser]
87 .. 87 G/A rs140767178 + CDS Nonsynonymous[Val11Met]
108 .. 108 C/T rs150127285 + CDS Nonsynonymous[Arg18Cys]
147 .. 147 G/C rs77091978 + CDS Nonsynonymous[Ala31Pro]
200 .. 200 T/C rs146989390 + CDS Synonymous[Asp48Asp]
241 .. 241 A/G rs149299444 + CDS Nonsynonymous[Asn62Ser]
253 .. 253 A/G rs77631323 + CDS Nonsynonymous[His66Arg]
266 .. 266 T/C rs142961157 + CDS Synonymous[Asp70Asp]
330 .. 330 G/A rs201268929 + CDS Nonsynonymous[Ala92Thr]
331 .. 331 C/T rs147452927 + CDS Nonsynonymous[Ala92Val]
411 .. 411 G/A rs138543005 + CDS Nonsynonymous[Glu119Lys]
418 .. 418 A/G rs150643555 + CDS Nonsynonymous[Lys121Arg]
423 .. 423 C/G rs149831189 + CDS Nonsynonymous[Gln123Glu]
437 .. 437 T/C rs200527953 + CDS Synonymous[Asn127Asn]
602 .. 602 C/T rs146868356 + CDS Synonymous[His182His]
621 .. 621 G/C rs144541020 + CDS Nonsynonymous[Asp189His]
653 .. 653 A/T rs199632589 + CDS Synonymous[Ser199Ser]
713 .. 713 C/T rs17230746 + CDS Synonymous[Tyr219Tyr]
794 .. 794 C/T rs200906734 + CDS Synonymous[Ser246Ser]
798 .. 798 A/G rs140266263 + CDS Nonsynonymous[Lys248Glu]
837 .. 837 C/T rs141398032 + CDS AA-STOP[Arg261*]
896 .. 896 C/T rs147986323 + CDS Synonymous[Gly280Gly]
905 .. 905 G/C rs138143506 + CDS Synonymous[Leu283Leu]
925 .. 925 A/G rs199912817 + CDS Nonsynonymous[Glu290Gly]
966 .. 966 G/A rs188001946 + CDS Nonsynonymous[Ala304Thr]
1033 .. 1033 A/G rs111540259 + CDS Nonsynonymous[Gln326Arg]
1079 .. 1079 C/T rs138120208 + CDS Synonymous[Asp341Asp]
1112 .. 1112 C/G rs149563619 + CDS Synonymous[Thr352Thr]
1194 .. 1194 A/G rs201853612 + CDS Nonsynonymous[Lys380Glu]
1216 .. 1216 G/T rs141487481 + CDS Nonsynonymous[Arg387Ile]
1255 .. 1255 C/T rs201019600 + CDS Nonsynonymous[Pro400Leu]
1263 .. 1263 C/T rs200956271 + CDS Nonsynonymous[Arg403Cys]
1286 .. 1286 T/C rs146358621 + CDS Synonymous[Phe410Phe]
1288 .. 1288 G/A rs113815280 + CDS Nonsynonymous[Gly411Glu]
1297 .. 1297 C/G rs199902781 + CDS Nonsynonymous[Thr414Ser]
1316 .. 1316 C/T rs200435567 + CDS Synonymous[Ala420Ala]
1330 .. 1330 T/C rs200952708 + CDS Nonsynonymous[Met425Thr]
1337 .. 1337 G/A rs139437131 + CDS Synonymous[Thr427Thr]
1343 .. 1343 C/T rs202023552 + CDS Synonymous[Ser429Ser]
1368 .. 1368 C/T rs11538443 - CDS Nonsynonymous[Leu438Phe]
1425 .. 1425 C/A rs145493919 + CDS Nonsynonymous[Gln457Lys]
1467 .. 1467 G/A rs147613962 + CDS Nonsynonymous[Gly471Ser]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer