H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000052101 Accession number: BC038976 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Rho GTPase-activating protein 15; ArhGAP15; Rho-type GTPase-activating protein 15;
 
 

Motif information
ORF

length(475),orf(57:1484)
MQKSTNSDTSVETLNSTRQGTGAVQMRIKNANSHHDRLSQSKSMILTDVG
KVTEPISRHRRNHSQHILKDVIPPLEQLMVEKEGYLQKAKIADGGKKLRK
NWSTSWIVLSSRRIEFYKESKQQALSNMKTGHKPESVDLCGAHIEWAKEK
SSRKNVFQITTVSGNEFLLQSDIDFIILDWFHAIKNAIDRLPKDSSCPSR
NLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNR
VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ
CIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHV
VTGALKMFFRELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLVQKLPP
PNRDTMKVLFGHLTKIVAKASKNLMSTQSLGIVFGPTLLRAENETGNMAI
HMVYQNQIAELMLSEYSKIFGSEED*
a.a.
length
InterPro Name
length(473), motif(1:473) 473 IPR015767 Rho GTPase activating protein [Family]
length(111), motif(79:189) 111 IPR001849 Pleckstrin homology domain [Domain]
length(113), motif(80:192) 113 IPR011993 Pleckstrin homology-like domain [Domain]
length(109), motif(80:188) 109 IPR001849 Pleckstrin homology domain [Domain]
length(112), motif(80:191) 112 IPR001849 Pleckstrin homology domain [Domain]
length(209), motif(263:471) 209 IPR000198 Rho GTPase-activating protein domain [Domain]
length(194), motif(277:470) 194 IPR008936 Rho GTPase activation protein [Domain]
length(190), motif(281:470) 190 IPR000198 Rho GTPase-activating protein domain [Domain]
length(176), motif(292:467) 176 IPR000198 Rho GTPase-activating protein domain [Domain]
length(150), motif(295:444) 150 IPR000198 Rho GTPase-activating protein domain [Domain]