H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000052436 Accession number: BC040630 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Aquaporin-8; AQP-8;
 
 

Motif information
ORF

length(259),orf(57:836)
LQIAMCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSALFIFIG
CLSVIENGTDTGLLQPALAHGLALGLVIATLGNISGGHFNPAVSLAAMLI
GGLNLVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNASGAAFVTVQEQG
QVAGALVAEIILTTLLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGG
PVSGGCMNPARAFGPAVVANHWNFHWIYWLGPLLAGLLVGLLIRCFIGDG
KTRLILKAR*
a.a.
length
InterPro Name
length(258), motif(2:259) 258 IPR000425 Major intrinsic protein [Family]
length(14), motif(3:16) 14 IPR023277 Aquaporin 8 [Family]
length(16), motif(22:37) 16 IPR023277 Aquaporin 8 [Family]
length(228), motif(23:250) 228 IPR023271 Aquaporin-like [Domain]
length(229), motif(24:252) 229 IPR023271 Aquaporin-like [Domain]
length(211), motif(31:241) 211 IPR000425 Major intrinsic protein [Family]
length(20), motif(34:53) 20 IPR000425 Major intrinsic protein [Family]
length(10), motif(54:63) 10 IPR023277 Aquaporin 8 [Family]
length(25), motif(70:94) 25 IPR000425 Major intrinsic protein [Family]
length(11), motif(74:84) 11 IPR023277 Aquaporin 8 [Family]
length(9), motif(88:96) 9 IPR022357 Major intrinsic protein, conserved site [Conserved_site]
length(12), motif(103:114) 12 IPR023277 Aquaporin 8 [Family]
length(20), motif(107:126) 20 IPR000425 Major intrinsic protein [Family]
length(14), motif(126:139) 14 IPR023277 Aquaporin 8 [Family]
length(13), motif(139:151) 13 IPR023277 Aquaporin 8 [Family]
length(19), motif(158:176) 19 IPR000425 Major intrinsic protein [Family]
length(11), motif(175:185) 11 IPR023277 Aquaporin 8 [Family]
length(23), motif(189:211) 23 IPR000425 Major intrinsic protein [Family]
length(21), motif(226:246) 21 IPR000425 Major intrinsic protein [Family]
length(10), motif(239:248) 10 IPR023277 Aquaporin 8 [Family]
length(11), motif(249:259) 11 IPR023277 Aquaporin 8 [Family]