H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000053536 Accession number: BC050642 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Alpha-enolase; EC=4.2.1.11; 2-phospho-D-glycerate hydro-lyase; C-myc promoter-binding protein; Enolase 1; MBP-1; MPB-1; Non-neural enolase; NNE; Phosphopyruvate hydratase; Plasminogen-binding protein;
 
 

Transcript original information
Accession number BC050642.2
CAGE tag ID NA
EST ID NA
Clone Number MGC:60133 IMAGE:6063437
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ENO1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ENO1);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 1898[bp] (No. of exon:13)[A:486 T:407 G:510 C:495]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Skin, melanotic melanoma.
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1827(+) Signal: 1801-1805(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGAAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0000101
Genomic location  G-integra Help Chromosome 1
Location 1p36.23
Position 8921062- 8953312
Strand -
Possible duplicated location(s) NA
Gene structure 13 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2023
KEGG GENES KEGG GENES(2023)
GeneCard GeneCardENO1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000099039
Predicted CDS 166..1470;  434[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.806
Database links RefSeq NP_001419
UniProt P06733
CCDS CCDS97

Motif information
ORF

length(434),orf(166:1470)
MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELR
DNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGT
ENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAF
NVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKY
GKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASE
FFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDD
WGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV
TESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCR
SERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK*
a.a.
length
InterPro Name
length(432), motif(1:432) 432 IPR000941 Enolase [Family]
length(136), motif(3:138) 136 IPR029017 Enolase N-terminal domain-like [Domain]
length(124), motif(3:126) 124 IPR029017 Enolase N-terminal domain-like [Domain]
length(132), motif(3:134) 132 IPR020811 Enolase, N-terminal [Domain]
length(427), motif(3:429) 427 IPR000941 Enolase [Family]
length(15), motif(35:49) 15 IPR000941 Enolase [Family]
length(17), motif(107:123) 17 IPR000941 Enolase [Family]
length(304), motif(128:431) 304 IPR029065 Enolase C-terminal domain-like [Domain]
length(289), motif(143:431) 289 IPR029065 Enolase C-terminal domain-like [Domain]
length(289), motif(143:431) 289 IPR020810 Enolase, C-terminal [Domain]
length(14), motif(164:177) 14 IPR000941 Enolase [Family]
length(12), motif(317:328) 12 IPR000941 Enolase [Family]
length(14), motif(340:353) 14 IPR020809 Enolase, conserved site [Conserved_site]
length(15), motif(340:354) 15 IPR000941 Enolase [Family]
length(18), motif(369:386) 18 IPR000941 Enolase [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000053536
H-Inv cluster ID Locus viewHIX0000101
Accession number BC050642.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Alpha-enolase; EC=4.2.1.11; 2-phospho-D-glycerate hydro-lyase; C-myc promoter-binding protein; Enolase 1; MBP-1; MPB-1; Non-neural enolase; NNE; Phosphopyruvate hydratase; Plasminogen-binding protein;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P06733)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 13692092005901237308135290907787969882471691101749150948930876096536459878089100825541068158910802057111343511149723912297304126661331470203915489334155924551613979816548883167104141681597517974005186696481960886119690332200682312126946021908771ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ENO1
HGNC aliases NA
HGNC name enolase 1, (alpha)
DDBJ ENO1
UniProt ENO1
EC number EC 4.2.1.11phosphopyruvate hydratase; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway 00010 :Glycolysis / Gluconeogenesis;  00400 :Phenylalanine, tyrosine and tryptophan biosynthesis; 
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000099039
No. of interaction 5
Interaction partner(s) HIP000034294HIP000082842HIP000091335HIP000120293HIP000136154
BIND 145679; 
DIP 133943E;  180033E; 
MINT MINT-2858506;  MINT-3304712;  MINT-49071;  MINT-49243;  MINT-51023;  MINT-7995173;  MINT-7995182;  MINT-7995334; 
HPRD 00010;  00017;  00032;  01417;  01456;  03183;  03229;  03387;  03465;  04078;  04585;  05496;  07601;  08442;  09113;  10584;  14358;  16050;  16246; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2023
KEGG GENES KEGG GENES(2023)
GeneCard GeneCardENO1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function phosphopyruvate hydratase activity (GO:0004634);  magnesium ion binding (GO:0000287); 
Biological process glycolysis (GO:0006096); 
Cellular component phosphopyruvate hydratase complex (GO:0000015); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
3 139 1e9iA2 2e-59 63.7 135/139 d.54.1.1
141 431 1e9iA1 3e-81 48.4 285/291 c.1.11.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus 201231_s_at; 
HG-U133 201231_s_at;  216554_s_at;  217294_s_at; 
HG-U133A 201231_s_at;  216554_s_at;  217294_s_at; 
HG-U133A_2 201231_s_at;  216554_s_at;  217294_s_at; 
HG-U133B NA
HG-U133_Plus_2 201231_s_at;  216554_s_at;  217294_s_at; 
HG-U95 2035_s_at; 
HG-U95A 2035_s_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2319118;  2395498;  2395499;  2395503;  2395504;  2395505;  2395507;  2395510;  2395518; 
HuGeneFL M14328_s_at; 
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_24_P105501;  A_32_P229365; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:27-May-2015
Disease relation Disease name:NA
Related information in OMIM OMIM ID:  172430;  Title: ENOLASE 1
Co-localized orphan diseases NA
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(2023)
Disease Entrez Gene ID:(2023)
Substance Entrez Gene ID:(2023)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Mus sp. (Mouse) AK002336 MGI:1894899 G-integraG-integra
Orthology Danio sp. (Zebrafish) BC059511 G-integraG-integra
Orthology Rattus sp. (Rat) BC078896 G-integraG-integra
Orthology Bos sp. (Cow) BC103354 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) CR726296 G-integraG-integra
Orthology Pongo sp. (Orangutan) CR860345 G-integraG-integra
Orthology Gallus sp. (Chicken) D37900 G-integraG-integra
Orthology Canis sp. (Dog) ENSCAFT00000031335 G-integraG-integra
Orthology Monodelphis sp. (Opossum) ENSMODT00000012118 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000007069 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000131536 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000150208 G-integraG-integra
Orthology Macaca sp. (Macaque) XM_001083033 G-integraG-integra
Orthology Macaca sp. (Macaque) XM_001098778 G-integraG-integra
Orthology Equus sp. (Horse) XM_001494862 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XM_514354 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
85 .. 85 C/T rs17032795 + 5'UTR
121 .. 121 C/T rs11544506 + 5'UTR
127 .. 127 C/T rs11544510 + 5'UTR
209 .. 209 G/T rs11544495 + CDS Nonsynonymous[Arg15Leu]
290 .. 290 G/C rs11544503 + CDS Nonsynonymous[Gly42Ala]
296 .. 296 A/G rs138834005 - CDS Nonsynonymous[Tyr44Cys]
332 .. 332 G/A rs201990176 - CDS Nonsynonymous[Arg56His]
340 .. 340 G/A rs142310173 - CDS Nonsynonymous[Gly59Arg]
366 .. 366 G/A rs28999074 + CDS Synonymous[Glu67Glu]
369 .. 369 C/T rs201513751 - CDS Synonymous[His68His]
374 .. 374 A/G rs201867667 - CDS Nonsynonymous[Asn70Ser]
388 .. 388 C/A rs146938354 - CDS Nonsynonymous[Pro75Thr]
396 .. 396 G/A rs28999075 + CDS Synonymous[Leu77Leu]
397 .. 397 G/T rs146619828 - CDS Nonsynonymous[Val78Phe]
447 .. 447 G/C rs11544491 + CDS Nonsynonymous[Met94Ile]
458 .. 458 A/G rs201943492 - CDS Nonsynonymous[Asp98Gly]
489 .. 489 G/A rs200935067 - CDS Synonymous[Ala108Ala]
517 .. 517 G/A rs199529530 - CDS Nonsynonymous[Val118Ile]
522 .. 522 C/T rs11544507 + CDS Synonymous[Cys119Cys]
535 .. 535 G/A/C rs11544519 + CDS
561 ^ 562 -/CC rs144538182 - CDS
564 .. 564 C/T rs11544497 + CDS Synonymous[His133His]
582 .. 582 C/A rs142256351 - CDS Synonymous[Gly139Gly]
660 .. 660 G/C rs11544509 + CDS Nonsynonymous[Met165Ile]
696 .. 696 C/A/T rs11544513 + CDS
732 .. 732 C/T rs11544499 + CDS Synonymous[Tyr189Tyr]
734 .. 734 A/G rs201627070 - CDS Nonsynonymous[His190Arg]
751 .. 751 A/G rs199771237 - CDS Nonsynonymous[Ile196Val]
799 .. 799 G/A rs201238976 - CDS Nonsynonymous[Gly212Arg]
875 .. 875 C/T rs148752848 - CDS Nonsynonymous[Thr237Ile]
889 .. 889 A/G rs138820314 - CDS Nonsynonymous[Ile242Val]
892 .. 892 G/A rs143707545 - CDS Nonsynonymous[Gly243Ser]
900 .. 900 C/G/T rs2230874 + CDS
905 .. 905 C/T rs201508705 - CDS Nonsynonymous[Ala247Val]
912 .. 912 C/T rs143076849 - CDS Synonymous[Ser249Ser]
913 .. 913 G/C/T rs11544512 + CDS
1062 .. 1062 T/C rs140944386 - CDS Synonymous[Asp299Asp]
1139 .. 1139 C/A rs11544514 + CDS Nonsynonymous[Pro325Gln]
1140 .. 1140 A/C rs140674283 - CDS Synonymous[Pro325Pro]
1152 .. 1152 C/A rs3180139 + CDS Synonymous[Ala329Ala]
1164 .. 1164 C/T rs146867004 - CDS Synonymous[Asn333Asn]
1229 .. 1229 A/C rs201636531 - CDS Nonsynonymous[Gln355Pro]
1235 .. 1235 G/A rs200008125 - CDS Nonsynonymous[Cys357Tyr]
1253 .. 1253 A/G rs151047591 - CDS Nonsynonymous[Asn363Ser]
1279 .. 1279 C/T rs150781341 - CDS Nonsynonymous[Arg372Cys]
1283 .. 1283 C/T rs143592223 - CDS Nonsynonymous[Ser373Leu]
1288 .. 1288 G/A rs3206672 + CDS Nonsynonymous[Glu375Lys]
1324 .. 1324 G/C rs11544489 + CDS Nonsynonymous[Gly387Arg]
1373 .. 1373 G/A rs201032262 - CDS Nonsynonymous[Arg403His]
1403 .. 1403 T/C rs201317089 - CDS Nonsynonymous[Ile413Thr]
1413 .. 1413 G/A rs193006639 - CDS Synonymous[Glu416Glu]
1458 .. 1458 C/T rs1065722 + CDS Synonymous[Pro431Pro]
1464 .. 1464 C/A rs139671695 - CDS Synonymous[Ala433Ala]
1470 .. 1470 A/G rs138375821 - CDS Synonymous_atSTOP[*435*]
1487 .. 1487 C/G rs1065725 + 3'UTR
1521 .. 1521 C/T rs11544498 + 3'UTR
1525 .. 1525 C/G rs3207089 + 3'UTR
1560 .. 1560 C/A rs3211543 + 3'UTR
1592 .. 1592 A/C rs3206703 + 3'UTR
1594 .. 1594 C/T rs11544504 + 3'UTR
1645 ^ 1646 -/C rs35715680 - 3'UTR
1678 .. 1678 C/T rs3206709 + 3'UTR
1695 .. 1695 T/A rs28999102 + 3'UTR
1714 .. 1714 A/C rs3199777 + 3'UTR
1721 .. 1721 A/C rs1065737 + 3'UTR
1733 .. 1733 G/A rs1059149 + 3'UTR
1753 .. 1753 C/T rs1803537 + 3'UTR
1756 .. 1756 C/T rs1059176 + 3'UTR
1769 .. 1769 A/C rs3206710 + 3'UTR
1822 .. 1822 A/G rs113945549 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
Alu 1 45 -
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer