H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000053892 Accession number: BC053506 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Protein phosphatase 1 regulatory subunit 16A.
 
 

Transcript original information
Accession number BC053506.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:59641 IMAGE:2823232
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (PPP1R16A) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (PPP1R16A);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 2326[bp] (No. of exon:10)[A:461 T:339 G:749 C:777]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Lung, small cell carcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence GCCGCCATGG
PolyA Site: 2274(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG; 
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0007864
Genomic location  G-integra Help Chromosome 8
Location 8q24.3
Position 145722109- 145727504
Strand +
Possible duplicated location(s) NA
Gene structure 10 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:84988
KEGG GENES KEGG GENES(84988)
GeneCard GeneCardPPP1R16A*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000025723
Predicted CDS 470..2056;  528[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.84
Database links RefSeq NP_116291
UniProt Q96I34
CCDS CCDS6429

Motif information
ORF

length(528),orf(470:2056)
MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGP
GERPRKEAASQGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLA
NEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTPLHAAATCGHL
HLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSI
EAARAVPELRMLDDIRSRLQAGADLHAPLDHGATLLHVAAANGFSEAAAL
LLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDET
PLDVCGDEEVRAKLLELKHKHDALLRAQSRQRSLLRRRTSSAGSRGKVVR
RVSLTQRTDLYRKQHAQEAIVWQQPPPTSPEPPEDNDDRQTGAELRPPPP
EEDNPEVVRPHNGRVGGSPVRHLYSKRLDRSVSYQLSPLDSTTPHTLVHD
KAHHTLADLKRQRAAAKLQRPPPEGPESPETAEPGLPGDTVTPQPDCGFR
AGGDPPLLKLTAPAVEAPVERRPCCLLM*
a.a.
length
InterPro Name
length(232), motif(74:305) 232 IPR020683 Ankyrin repeat-containing domain [Domain]
length(228), motif(75:302) 228 IPR020683 Ankyrin repeat-containing domain [Domain]
length(231), motif(75:305) 231 IPR020683 Ankyrin repeat-containing domain [Domain]
length(91), motif(75:165) 91 IPR020683 Ankyrin repeat-containing domain [Domain]
length(30), motif(103:132) 30 IPR002110 Ankyrin repeat [Repeat]
length(33), motif(103:135) 33 IPR002110 Ankyrin repeat [Repeat]
length(33), motif(136:168) 33 IPR002110 Ankyrin repeat [Repeat]
length(30), motif(136:165) 30 IPR002110 Ankyrin repeat [Repeat]
length(76), motif(219:294) 76 IPR020683 Ankyrin repeat-containing domain [Domain]
length(33), motif(231:263) 33 IPR002110 Ankyrin repeat [Repeat]
length(30), motif(231:260) 30 IPR002110 Ankyrin repeat [Repeat]
length(16), motif(232:247) 16 IPR002110 Ankyrin repeat [Repeat]
length(30), motif(264:293) 30 IPR002110 Ankyrin repeat [Repeat]
length(33), motif(264:296) 33 IPR002110 Ankyrin repeat [Repeat]
length(15), motif(280:294) 15 IPR002110 Ankyrin repeat [Repeat]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000053892
H-Inv cluster ID Locus viewHIX0007864
Accession number BC053506.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Protein phosphatase 1 regulatory subunit 16A.
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (NP_116291)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol PPP1R16A
HGNC aliases "protein phosphatase 1, regulatory (inhibitor) subunit 16A"
HGNC name protein phosphatase 1, regulatory subunit 16A
DDBJ PPP1R16A
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000025723
No. of interaction 3
Interaction partner(s) HIP000014859HIP000031586HIP000102422
BIND NA
DIP NA
MINT MINT-65180;  MINT-65181;  MINT-65182;  MINT-65183;  MINT-65185;  MINT-65186;  MINT-65187;  MINT-65188;  MINT-65189;  MINT-65190;  MINT-68029; 
HPRD 00877;  00935;  03068;  04242;  04691;  06659;  09132;  09560;  10859;  13019;  17021;  18051; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:84988
KEGG GENES KEGG GENES(84988)
GeneCard GeneCardPPP1R16A*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function protein binding (GO:0005515); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
22 322 1s70B 6e-50 38.3 287/291 d.211.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus NA
HG-U133 225203_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 225203_at; 
HG-U133_Plus_2 225203_at; 
HG-U95 53721_at; 
HG-U95A NA
HG-U95B 53721_at; 
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3120642;  3120644;  3120646;  3120648;  3120649;  3120651;  3120652; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P157715; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P157715;  A_24_P9605; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
136 .. 136 C/T rs140635105 + 5'UTR
160 .. 160 C/G rs149977141 + 5'UTR
365 .. 365 C/T rs111647396 + 5'UTR
377 .. 377 T/A rs145163729 + 5'UTR
389 .. 389 C/A rs141236578 + 5'UTR
440 .. 440 G/A rs190529419 + 5'UTR
475 .. 475 C/T rs199970872 + CDS Synonymous[Ala2Ala]
476 .. 476 G/A rs201175578 + CDS Nonsynonymous[Glu3Lys]
512 .. 512 G/C rs149436932 + CDS Nonsynonymous[Gly15Arg]
514 .. 514 C/A rs61749074 + CDS Synonymous[Gly15Gly]
516 .. 516 G/A rs200210137 + CDS Nonsynonymous[Arg16Lys]
555 .. 555 G/A rs200756116 + CDS Nonsynonymous[Arg29Gln]
560 .. 560 G/A rs148405688 + CDS Nonsynonymous[Ala31Thr]
591 .. 591 A/G rs201796418 + CDS Nonsynonymous[Glu41Gly]
627 .. 627 G/A rs142532469 + CDS Nonsynonymous[Arg53His]
650 .. 650 C/A rs145969525 + CDS Nonsynonymous[Gln61Lys]
732 .. 732 G/A rs200234267 + CDS Nonsynonymous[Arg88His]
739 .. 739 C/T rs139881624 + CDS Synonymous[Phe90Phe]
758 .. 758 C/A rs199589593 + CDS Nonsynonymous[Pro97Thr]
772 .. 772 C/T rs199683628 + CDS Synonymous[Asn101Asn]
778 .. 778 C/T rs143363043 + CDS Synonymous[Asp103Asp]
790 .. 790 C/T rs200603406 + CDS Synonymous[Ala107Ala]
817 .. 817 C/T rs146731049 + CDS Synonymous[Phe116Phe]
885 .. 885 C/T rs201560921 + CDS Nonsynonymous[Thr139Met]
901 .. 901 G/A rs114186172 + CDS Synonymous[Ala144Ala]
903 .. 903 C/T rs140350060 + CDS Nonsynonymous[Ala145Val]
906 .. 906 C/T rs200134453 + CDS Nonsynonymous[Thr146Ile]
910 .. 910 C/T rs116207493 + CDS Synonymous[Cys147Cys]
949 .. 949 C/T rs201015331 + CDS Synonymous[Gly160Gly]
970 .. 970 C/T rs187443246 + CDS Synonymous[Asn167Asn]
976 .. 976 C/T rs199905128 + CDS Synonymous[Asp169Asp]
1009 .. 1009 G/A rs202055214 + CDS Synonymous[Glu180Glu]
1021 .. 1021 C/A rs145132792 + CDS Nonsynonymous[Asp184Glu]
1253 .. 1253 G/A rs12542399 + CDS Nonsynonymous[Asp262Asn]
1264 .. 1264 C/T rs1871542 + CDS Synonymous[Gly265Gly]
1315 .. 1315 G/C rs148927692 + CDS Nonsynonymous[Glu282Asp]
1355 .. 1355 C/G rs4581096 + CDS Nonsynonymous[Leu296Val]
1391 .. 1391 G/C rs4451341 + CDS Nonsynonymous[Glu308Gln]
1411 .. 1411 G/T rs4520204 + CDS Synonymous[Leu314Leu]
1413 .. 1413 T/G rs112902507 + CDS Nonsynonymous[Leu315Arg]
1417 .. 1417 G/A rs4372045 + CDS Synonymous[Glu316Glu]
1423 .. 1423 G/A rs4372046 + CDS Synonymous[Lys318Lys]
1486 .. 1486 C/A rs59798065 + CDS Synonymous[Thr339Thr]
1541 .. 1541 A/G rs4378003 + CDS Nonsynonymous[Thr358Ala]
1588 .. 1588 A/G rs200051514 + CDS Synonymous[Gln373Gln]
1605 .. 1605 G/A rs138377500 + CDS Nonsynonymous[Ser379Asn]
1646 .. 1646 G/A rs199705423 + CDS Nonsynonymous[Ala393Thr]
1675 .. 1675 G/C rs142450169 + CDS Nonsynonymous[Glu402Asp]
1711 .. 1711 A/G rs146709136 + CDS Synonymous[Arg414Arg]
1749 .. 1749 G/T rs200095776 + CDS Nonsynonymous[Arg427Leu]
1758 .. 1758 G/A rs146639111 + CDS Nonsynonymous[Arg430Gln]
1797 .. 1797 C/T rs139247503 + CDS Nonsynonymous[Thr443Ile]
1800 .. 1800 C/T rs141554257 + CDS Nonsynonymous[Pro444Leu]
1817 .. 1817 G/A rs150902628 + CDS Nonsynonymous[Asp450Asn]
1850 .. 1850 C/T rs202199621 + CDS Nonsynonymous[Arg461Cys]
1909 .. 1909 G/A rs138353402 + CDS Synonymous[Glu480Glu]
2010 .. 2010 C/T rs61740411 + CDS Nonsynonymous[Ala514Val]
2041 .. 2041 C/T rs202096061 + CDS Synonymous[Cys524Cys]
2050 .. 2050 C/T rs6988333 + CDS Synonymous[Leu527Leu]
2087 .. 2087 G/T rs2721198 - 3'UTR
2089 .. 2089 G/A rs201375969 + 3'UTR
2095 .. 2095 A/G rs186831096 + 3'UTR
2161 .. 2161 C/T rs1044618 + 3'UTR
2174 .. 2174 C/T rs140001090 + 3'UTR
2177 .. 2177 T/G rs192904904 + 3'UTR
2213 .. 2213 T/C rs79355846 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer