H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000053892 Accession number: BC053506 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Protein phosphatase 1 regulatory subunit 16A.
 
 

Motif information
ORF

length(528),orf(470:2056)
MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGP
GERPRKEAASQGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLA
NEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTPLHAAATCGHL
HLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSI
EAARAVPELRMLDDIRSRLQAGADLHAPLDHGATLLHVAAANGFSEAAAL
LLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDET
PLDVCGDEEVRAKLLELKHKHDALLRAQSRQRSLLRRRTSSAGSRGKVVR
RVSLTQRTDLYRKQHAQEAIVWQQPPPTSPEPPEDNDDRQTGAELRPPPP
EEDNPEVVRPHNGRVGGSPVRHLYSKRLDRSVSYQLSPLDSTTPHTLVHD
KAHHTLADLKRQRAAAKLQRPPPEGPESPETAEPGLPGDTVTPQPDCGFR
AGGDPPLLKLTAPAVEAPVERRPCCLLM*
a.a.
length
InterPro Name
length(232), motif(74:305) 232 IPR020683 Ankyrin repeat-containing domain [Domain]
length(228), motif(75:302) 228 IPR020683 Ankyrin repeat-containing domain [Domain]
length(231), motif(75:305) 231 IPR020683 Ankyrin repeat-containing domain [Domain]
length(91), motif(75:165) 91 IPR020683 Ankyrin repeat-containing domain [Domain]
length(30), motif(103:132) 30 IPR002110 Ankyrin repeat [Repeat]
length(33), motif(103:135) 33 IPR002110 Ankyrin repeat [Repeat]
length(33), motif(136:168) 33 IPR002110 Ankyrin repeat [Repeat]
length(30), motif(136:165) 30 IPR002110 Ankyrin repeat [Repeat]
length(76), motif(219:294) 76 IPR020683 Ankyrin repeat-containing domain [Domain]
length(33), motif(231:263) 33 IPR002110 Ankyrin repeat [Repeat]
length(30), motif(231:260) 30 IPR002110 Ankyrin repeat [Repeat]
length(16), motif(232:247) 16 IPR002110 Ankyrin repeat [Repeat]
length(30), motif(264:293) 30 IPR002110 Ankyrin repeat [Repeat]
length(33), motif(264:296) 33 IPR002110 Ankyrin repeat [Repeat]
length(15), motif(280:294) 15 IPR002110 Ankyrin repeat [Repeat]