H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000053920 Accession number: BC053562 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: CREB-regulated transcription coactivator 2; Transducer of regulated cAMP response element-binding protein 2; TORC-2; Transducer of CREB protein 2;
 
 

Transcript original information
Accession number BC053562.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:61711 IMAGE:6188068
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (CRTC2) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (CRTC2);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 2598[bp] (No. of exon:14)[A:537 T:540 G:660 C:861]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Peripheral Nervous System, sympathetic trunk
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 2584(+) Signal: 2567-2571(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001094
Genomic location  G-integra Help Chromosome 1
Location 1q21.3
Position 153920153- 153931043
Strand -
Possible duplicated location(s) NA
Gene structure 14 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:200186
KEGG GENES KEGG GENES(200186)
GeneCard GeneCardCRTC2*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000035962
Predicted CDS 71..2152;  693[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.787
Database links RefSeq NP_859066
UniProt Q53ET0
CCDS CCDS30875

Motif information
ORF

length(693),orf(71:2152)
MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGST
RLQAQKLRLAYTRSSHYGGSLPNVNQIGSGLAEFQSPLHSPLDSSRSTRH
HGLVERVQRDPRRMVSPLRRYTRHIDSSPYSPAYLSPPPESSWRRTMAWG
NFPAEKGQLFRLPSALNRTSSDSALHTSVMNPSPQDTYPGPTPPSILPSR
RGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSSRPRSCEVPGI
NIFPSPDQPANVPVLPPAMNTGGSLPDLTNLHFPPPLPTPLDPEETAYPS
LSGGNSTSNLTHTMTHLGISRGMGLGPGYDAPGLHSPLSHPSLQSSLSNP
NLQASLSSPQPQLQGSHSHPSLPASSLARHVLPTTSLGHPSLSAPALSSS
SSSSSTSSPVLGAPSYPASTPGASPHHRRVPLSPLSLLAGPADARRSQQQ
LPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSSPSLVLPTQPH
TPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRP
MSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTF
NHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLEL
GLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ*
a.a.
length
InterPro Name
length(680), motif(14:693) 680 IPR024786 Transducer of regulated CREB activity [Family]
length(54), motif(18:71) 54 IPR024783 Transducer of regulated CREB activity, N-terminal [Domain]
length(153), motif(168:320) 153 IPR024784 Transducer of regulated CREB activity, middle domain [Domain]
length(78), motif(615:692) 78 IPR024785 Transducer of regulated CREB activity, C-terminal [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000053920
H-Inv cluster ID Locus viewHIX0001094
Accession number BC053562.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition CREB-regulated transcription coactivator 2; Transducer of regulated cAMP response element-binding protein 2; TORC-2; Transducer of CREB protein 2;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q53ET0)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 14506290145360811545408115489334155891601671041416809310168179011696424316980408172102231795001918220336186260181866964819690332200682312126946021406692ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol CRTC2
HGNC aliases NA
HGNC name CREB regulated transcription coactivator 2
DDBJ CRTC2
UniProt CRTC2
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000035962
No. of interaction 110
Interaction partner(s) HIP000021161HIP000021251HIP000021280HIP000022299HIP000022562HIP000022865HIP000024053HIP000024064HIP000024836HIP000025941HIP000026502HIP000026993HIP000027278HIP000027491HIP000027837HIP000028330HIP000029731HIP000030905HIP000032546HIP000033428HIP000033680HIP000035338HIP000036301HIP000036301HIP000039355HIP000039361HIP000039935HIP000039935HIP000041319HIP000043673HIP000043710HIP000044376HIP000048632HIP000048659HIP000048930HIP000049801HIP000051954HIP000051954HIP000054054HIP000054054HIP000054389HIP000054588HIP000054854HIP000054887HIP000054887HIP000054970HIP000055482HIP000055518HIP000056413HIP000058501HIP000058501HIP000058866HIP000061780HIP000063429HIP000068321HIP000068776HIP000071861HIP000072207HIP000074075HIP000074075HIP000076344HIP000076980HIP000079679HIP000080449HIP000081174HIP000082842HIP000083571HIP000086094HIP000089414HIP000091335HIP000092377HIP000092689HIP000092689HIP000093055HIP000095643HIP000095643HIP000095695HIP000098800HIP000099374HIP000099374HIP000100528HIP000101685HIP000102597HIP000102812HIP000103653HIP000104541HIP000105273HIP000105926HIP000106021HIP000109494HIP000111395HIP000111395HIP000113162HIP000114524HIP000116636HIP000123754HIP000134691HIP000135397HIP000136553HIP000137294HIP000192131HIP000196298HIP000253715HIP000256011HIP000258716HIP000258716HIP000337559HIP000357422HIP000358996HIP000436453
BIND 181862;  181863;  181864; 
DIP 180276E;  59462E; 
MINT MINT-4980008;  MINT-50901;  MINT-50989;  MINT-8006769; 
HPRD 00234;  03183;  03184;  03442;  05639;  09301;  11121;  12348; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:200186
KEGG GENES KEGG GENES(200186)
GeneCard GeneCardCRTC2*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function cAMP response element binding protein binding (GO:0008140); 
Biological process activation of CREB transcription factor (GO:0032793);  protein homotetramerization (GO:0051289); 
Cellular component nucleus (GO:0005634);  cytoplasm (GO:0005737); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsC221311; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 226307_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 226307_at; 
HG-U133_Plus_2 226307_at; 
HG-U95 55619_at; 
HG-U95A NA
HG-U95B 55619_at; 
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2359983;  2359985;  2436340;  2436341;  2436342;  2436343;  2436346;  2436347;  2436348;  2436349;  2436350;  2436351;  2436352;  2436356;  2436357;  2436359;  2436361;  2436363;  2436365;  2436367;  2436370;  2436372;  2436374;  2436375;  2436376;  2811671; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P12173; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P12173;  A_23_P12178; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Mus sp. (Mouse) BC033300 MGI:1921593 G-integraG-integra
Orthology Bos sp. (Cow) BC123454 G-integraG-integra
Orthology Rattus sp. (Rat) BC128708 G-integraG-integra
Orthology Danio sp. (Zebrafish) ENSDART00000073903 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000000213 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000000961 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00009705001 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000178982 G-integraG-integra
Orthology Macaca sp. (Macaque) XM_001112030 G-integraG-integra
Orthology Danio sp. (Zebrafish) XM_001339840 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001372591 G-integraG-integra
Orthology Equus sp. (Horse) XM_001495407 G-integraG-integra
Orthology Canis sp. (Dog) XM_850049 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XR_020172 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
1 .. 1 G/A rs182279934 - 5'UTR
93 .. 93 G/A rs148383102 - CDS Nonsynonymous[Gly8Glu]
108 .. 108 C/T rs145098683 - CDS Nonsynonymous[Thr13Met]
109 .. 109 G/T rs190031226 - CDS Synonymous[Thr13Thr]
112 .. 112 C/T rs146574814 - CDS Synonymous[Ala14Ala]
253 .. 253 C/T rs148955330 - CDS Synonymous[Tyr61Tyr]
289 .. 289 T/C rs149775311 - CDS Synonymous[Asn73Asn]
431 .. 431 T/C rs145219132 - CDS Nonsynonymous[Tyr121His]
509 .. 509 A/G rs11264680 - CDS Nonsynonymous[Met147Val]
514 .. 514 C/A rs141182320 - CDS Synonymous[Ala148Ala]
522 .. 522 A/G rs200094386 - CDS Nonsynonymous[Asn151Ser]
559 .. 559 A/G rs200510096 - CDS Synonymous[Pro163Pro]
589 .. 589 T/C rs200892316 - CDS Synonymous[Ser173Ser]
595 .. 595 T/G rs201377140 - CDS Synonymous[Leu175Leu]
624 .. 624 A/G rs201941085 - CDS Nonsynonymous[Gln185Arg]
672 .. 672 G/A rs199770709 - CDS Nonsynonymous[Arg201His]
675 .. 675 G/A rs149465782 - CDS Nonsynonymous[Gly202Glu]
739 .. 739 C/A rs61804848 - CDS Nonsynonymous[Asp223Glu]
769 .. 769 G/A rs138937027 - CDS Synonymous[Lys233Lys]
775 .. 775 A/G rs142951728 - CDS Synonymous[Leu235Leu]
829 .. 829 T/C rs200042478 - CDS Synonymous[Phe253Phe]
868 .. 868 A/C rs201473293 - CDS Synonymous[Pro266Pro]
882 .. 882 C/T rs200591440 - CDS Nonsynonymous[Thr271Met]
913 .. 913 G/T rs146129937 - CDS Synonymous[Leu281Leu]
1035 .. 1035 G/T rs200091206 - CDS Nonsynonymous[Gly322Val]
1109 .. 1109 C/A rs1934436 + CDS Nonsynonymous[Leu347Ile]
1136 .. 1136 C/A rs1934437 + CDS Nonsynonymous[Leu356Met]
1165 .. 1165 C/T rs140478756 - CDS Synonymous[Gly365Gly]
1205 .. 1205 C/T rs150423770 - CDS Nonsynonymous[Arg379Cys]
1206 .. 1206 G/A rs143226168 - CDS Nonsynonymous[Arg379His]
1227 .. 1227 C/T rs200739285 - CDS Nonsynonymous[Ser386Phe]
1261 .. 1261 T/C rs17854826 - CDS Synonymous[Leu397Leu]
1306 .. 1306 C/T rs201148360 - CDS Synonymous[Gly412Gly]
1309 .. 1309 C/A rs201467539 - CDS Synonymous[Ala413Ala]
1338 .. 1338 C/G rs202092600 - CDS Nonsynonymous[Ala423Gly]
1384 .. 1384 C/T rs149147178 - CDS Synonymous[Leu438Leu]
1396 .. 1396 C/T rs145272706 - CDS Synonymous[Ala442Ala]
1399 .. 1399 C/T rs149725052 - CDS Synonymous[Asp443Asp]
1400 .. 1400 G/A rs139505722 - CDS Nonsynonymous[Ala444Thr]
1515 .. 1515 G/A rs142507189 - CDS Nonsynonymous[Arg482Gln]
1523 .. 1523 C/G rs111767182 - CDS Nonsynonymous[Pro485Ala]
1523 ^ 1524 -/C rs35857186 - CDS
1548 .. 1548 T/G rs201439820 - CDS Nonsynonymous[Leu493Arg]
1570 .. 1570 C/A rs200333663 - CDS Nonsynonymous[His500Gln]
1597 .. 1597 G/T rs201626667 - CDS Synonymous[Gly509Gly]
1614 .. 1614 G/C rs201034038 - CDS Nonsynonymous[Cys515Ser]
1672 .. 1672 G/A rs143017611 - CDS Synonymous[Pro534Pro]
1714 .. 1714 C/T rs201931769 - CDS Synonymous[His548His]
1716 .. 1716 G/A rs200773596 - CDS Nonsynonymous[Arg549Gln]
1722 .. 1722 T/A rs200292489 - CDS Nonsynonymous[Met551Lys]
1780 .. 1780 C/G rs201098465 - CDS Nonsynonymous[Ser570Arg]
1811 .. 1811 G/A rs187465892 - CDS Nonsynonymous[Gly581Arg]
1932 .. 1932 G/A rs202045208 - CDS Nonsynonymous[Gly621Glu]
1939 .. 1939 C/G rs138486317 - CDS Synonymous[Ser623Ser]
1967 .. 1967 G/A rs199941170 - CDS Nonsynonymous[Ala633Thr]
1978 .. 1978 C/T rs138788943 - CDS Synonymous[Ala636Ala]
1979 .. 1979 G/A rs140933480 - CDS Nonsynonymous[Gly637Arg]
1984 .. 1984 G/A rs141962023 - CDS Synonymous[Val638Val]
1997 .. 1997 G/A rs182932650 - CDS Nonsynonymous[Val643Met]
2014 .. 2014 G/A rs200008976 - CDS Synonymous[Leu648Leu]
2022 .. 2022 G/A rs141409588 - CDS Nonsynonymous[Gly651Glu]
2040 .. 2040 A/C rs199719013 - CDS Nonsynonymous[Glu657Ala]
2045 .. 2045 C/T rs149096848 - CDS Nonsynonymous[Arg659Cys]
2149 .. 2149 A/G rs201718464 - CDS Synonymous[Gln693Gln]
2173 .. 2173 T/C rs10559 - 3'UTR
2451 .. 2451 C/T rs8450 + 3'UTR
2545 .. 2545 A/G rs41312716 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer