H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000053920 Accession number: BC053562 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: CREB-regulated transcription coactivator 2; Transducer of regulated cAMP response element-binding protein 2; TORC-2; Transducer of CREB protein 2;
 
 

Motif information
ORF

length(693),orf(71:2152)
MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGST
RLQAQKLRLAYTRSSHYGGSLPNVNQIGSGLAEFQSPLHSPLDSSRSTRH
HGLVERVQRDPRRMVSPLRRYTRHIDSSPYSPAYLSPPPESSWRRTMAWG
NFPAEKGQLFRLPSALNRTSSDSALHTSVMNPSPQDTYPGPTPPSILPSR
RGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSSRPRSCEVPGI
NIFPSPDQPANVPVLPPAMNTGGSLPDLTNLHFPPPLPTPLDPEETAYPS
LSGGNSTSNLTHTMTHLGISRGMGLGPGYDAPGLHSPLSHPSLQSSLSNP
NLQASLSSPQPQLQGSHSHPSLPASSLARHVLPTTSLGHPSLSAPALSSS
SSSSSTSSPVLGAPSYPASTPGASPHHRRVPLSPLSLLAGPADARRSQQQ
LPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSSPSLVLPTQPH
TPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRP
MSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTF
NHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLEL
GLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ*
a.a.
length
InterPro Name
length(680), motif(14:693) 680 IPR024786 Transducer of regulated CREB activity [Family]
length(54), motif(18:71) 54 IPR024783 Transducer of regulated CREB activity, N-terminal [Domain]
length(153), motif(168:320) 153 IPR024784 Transducer of regulated CREB activity, middle domain [Domain]
length(78), motif(615:692) 78 IPR024785 Transducer of regulated CREB activity, C-terminal [Domain]