H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000053981 Accession number: BC053688 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Rho GTPase-activating protein 30 isoform 1.
 
 

Transcript original information
Accession number BC053688.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:61682 IMAGE:5213184
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ARHGAP30) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ARHGAP30);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 3522[bp] (No. of exon:13)[A:793 T:732 G:1037 C:960]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Blood, adult leukocytes
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 3482(+) Signal: 3464-3468(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG;  TAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001227
Genomic location  G-integra Help Chromosome 1
Location 1q23.3
Position 161016738- 161039456
Strand -
Possible duplicated location(s) NA
Gene structure 13 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:257106
KEGG GENES KEGG GENES(257106)
GeneCard GeneCardARHGAP30*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000069953
Predicted CDS 43..2715;  890[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.785

Motif information
ORF

length(890),orf(43:2715)
MKSRQKGKKKGSAKERVFGCDLQEHLQHSGQEVPQVLKSCAEFVEEYGVV
DGIYRLSGVSSNIQKLRQELESERKPDLRRDVYLQDIHCVSSLCKAYFRE
LPDPLLTYRLYDKFAEAVGVQLEPERLVKILEVLRELPVPNYRTLEFLMR
HLVHMASFSAQTNMHARNLAIVWAPNLLRSKDIEASGFNGTAAFMEVRVQ
SIVVEFILTHVDQLFGGAALSGGEVESGWRSLPGTRASGSPEDLMPRPLP
YHLPSILQAGDGPPQMRPYHTIIEIAEHKRKGSLKVRKWRSIFNLGRSGH
ETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAGASDEPEGLVGPSSP
RPSPLLPESLENDSIEAAEGEQEPEAEALGGTNSEPGTPRAGRSAIRAGG
SSRAERCAGVHISDPYNVNLPLHITSILSVPPNIISNVSLARLTRGLECP
ALQHRPSPASGPGPGPGLGPGPPDEKLEASPASSPLADSGPDDLAPALED
SLSQEVQDSFSFLEDSSSSEPEWVGAEDGEVAQAEAAGAAFSPGEDDPGM
GYLEELLGVGPQVEEFSVEPPLDDLSLDEAQFVLAPSCCSVDSAGPRPEV
EEENGEEVFLSAYDDLSPLLGPKPPIWKGSGSLEGEAAGCGRQALGQGGE
EQACWEVGEDKQAEPGGRLDIREEAEGSPQPPQPEEMEPEGQPSPDGCLC
PCSLGLGGVGMRLASTLVQVQQVRSVPVVPPKPQFAKMPSAMCSKIHVAP
ANPCPRPGRLDGTPGERAWGSRASRSSWRNGGSLSFDAAVALARDRQRTE
AQGVRRTQTCTEGGDYCLIPRTSPCSMISAHSPRPLSCLELPSEGAEGSG
SRSRLSLPPREPQVPDPLLSSQRRSYAFETQANPGKGEGL*
a.a.
length
InterPro Name
length(200), motif(16:215) 200 IPR008936 Rho GTPase activation protein [Domain]
length(196), motif(20:215) 196 IPR000198 Rho GTPase-activating protein domain [Domain]
length(194), motif(22:215) 194 IPR000198 Rho GTPase-activating protein domain [Domain]
length(182), motif(31:212) 182 IPR000198 Rho GTPase-activating protein domain [Domain]
length(149), motif(34:182) 149 IPR000198 Rho GTPase-activating protein domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000053981
H-Inv cluster ID Locus viewHIX0001227
Accession number BC053688.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Similar to Rho GTPase-activating protein 30 isoform 1.
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (NP_001020769)  [Identity/coverage = 99.775%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ARHGAP30
HGNC aliases NA
HGNC name Rho GTPase activating protein 30
DDBJ ARHGAP30
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000069953
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:257106
KEGG GENES KEGG GENES(257106)
GeneCard GeneCardARHGAP30*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Biological process signal transduction (GO:0007165); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
16 215 1xa6A1 3e-50 30.8 195/196 a.116.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus NA
HG-U133 226219_at;  241346_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 226219_at;  241346_at; 
HG-U133_Plus_2 226219_at;  241346_at; 
HG-U95 43495_at;  47973_at;  79368_at; 
HG-U95A NA
HG-U95B 43495_at;  47973_at; 
HG-U95C NA
HG-U95D NA
HG-U95E 79368_at; 
HG-U95Av2 NA
HuEx-1_0 2440550;  2440551;  2440552;  2440553;  2440554;  2440555;  2440556;  2440557;  2440558;  2440559;  2440560;  2440561;  2440564;  2440565;  2440567;  2440568;  2440570;  2440571;  2440572;  2440574;  2440575;  2440577;  2440578;  2440579;  2440581;  2440582;  2440584;  2440585; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P35045; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P35045;  A_24_P911231; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
18 .. 18 G/A rs183626324 - 5'UTR
52 .. 52 C/T rs149081252 - CDS Nonsynonymous[Arg4Trp]
66 .. 66 G/A rs199913465 - CDS Synonymous[Lys8Lys]
246 .. 246 G/C rs139098287 - CDS Nonsynonymous[Gln68His]
252 .. 252 G/T rs17854839 - CDS Nonsynonymous[Leu70Phe]
263 .. 263 G/A rs143165869 - CDS Nonsynonymous[Arg74Gln]
276 .. 276 G/T rs113612837 - CDS Synonymous[Leu78Leu]
280 .. 280 C/T rs200039326 - CDS Nonsynonymous[Arg80Trp]
370 .. 370 C/T rs143974805 - CDS Nonsynonymous[Leu110Phe]
384 .. 384 T/C rs200369587 - CDS Synonymous[Phe114Phe]
428 .. 428 A/G rs146389701 - CDS Nonsynonymous[Lys129Arg]
556 .. 556 G/A rs200609833 - CDS Nonsynonymous[Val172Met]
617 .. 617 C/T rs142652376 - CDS Nonsynonymous[Ala192Val]
621 .. 621 C/T rs148479983 - CDS Synonymous[Ala193Ala]
637 .. 637 G/A rs201430715 - CDS Nonsynonymous[Val199Ile]
645 .. 645 C/T rs199992109 - CDS Synonymous[Ser201Ser]
652 .. 652 G/A rs149577194 - CDS Nonsynonymous[Val204Met]
664 .. 664 C/T rs147495462 - CDS Nonsynonymous[Leu208Phe]
680 .. 680 A/G rs139071778 - CDS Nonsynonymous[Gln213Arg]
681 .. 681 G/A rs118099463 - CDS Synonymous[Gln213Gln]
689 .. 689 G/T rs150160922 - CDS Nonsynonymous[Gly216Val]
706 .. 706 G/A rs143553249 - CDS Nonsynonymous[Gly222Ser]
712 .. 712 G/A rs202221316 - CDS Nonsynonymous[Glu224Lys]
725 .. 725 G/C rs146693161 - CDS Nonsynonymous[Gly228Ala]
734 .. 734 C/T rs200926712 - CDS Nonsynonymous[Ser231Leu]
743 .. 743 G/A rs140780168 - CDS Nonsynonymous[Gly234Glu]
761 .. 761 G/A rs200182799 - CDS Nonsynonymous[Ser240Asn]
807 .. 807 C/A rs113000707 - CDS Nonsynonymous[Ser255Arg]
831 .. 831 C/T rs149842140 - CDS Synonymous[Pro263Pro]
882 .. 882 G/A rs150654338 - CDS Synonymous[Arg280Arg]
903 .. 903 G/A rs140126629 - CDS Synonymous[Arg287Arg]
935 .. 935 C/T rs143139075 - CDS Nonsynonymous[Ser298Phe]
936 .. 936 T/C rs144239314 - CDS Synonymous[Ser298Ser]
965 .. 965 G/A rs149524176 - CDS Nonsynonymous[Arg308Gln]
970 .. 970 G/C rs79516979 - CDS Nonsynonymous[Ala310Pro]
978 .. 978 C/T rs149661287 - CDS Synonymous[Asp312Asp]
1038 .. 1038 T/A rs202022472 - CDS Nonsynonymous[Ser332Arg]
1075 .. 1075 G/A rs140334248 - CDS Nonsynonymous[Val345Met]
1076 .. 1076 T/G rs201591076 - CDS Nonsynonymous[Val345Gly]
1087 .. 1087 A/G rs144647339 - CDS Nonsynonymous[Ser349Gly]
1105 .. 1105 T/C rs150920217 - CDS Synonymous[Leu355Leu]
1118 .. 1118 G/A rs142510619 - CDS Nonsynonymous[Ser359Asn]
1129 .. 1129 G/A rs145698042 - CDS Nonsynonymous[Asp363Asn]
1136 .. 1136 T/C rs147935735 - CDS Nonsynonymous[Ile365Thr]
1150 .. 1150 G/A rs140821479 - CDS Nonsynonymous[Gly370Ser]
1177 .. 1177 C/G rs200564175 - CDS Nonsynonymous[Leu379Val]
1186 .. 1186 A/G rs199763567 - CDS Nonsynonymous[Thr382Ala]
1229 .. 1229 T/C rs141836848 - CDS Nonsynonymous[Ile396Thr]
1232 .. 1232 G/A rs144590603 - CDS Nonsynonymous[Arg397Gln]
1241 .. 1241 G/T rs76696132 - CDS Nonsynonymous[Gly400Val]
1328 .. 1328 G/A rs138641411 - CDS Nonsynonymous[Ser429Asn]
1371 .. 1371 C/T rs201605667 - CDS Synonymous[Leu443Leu]
1434 .. 1434 T/C rs144785706 - CDS Synonymous[Pro464Pro]
1445 .. 1445 T/C rs201733366 - CDS Nonsynonymous[Leu468Pro]
1460 .. 1460 C/T rs150334154 - CDS Nonsynonymous[Pro473Leu]
1509 .. 1509 A/C rs151150229 - CDS Synonymous[Ser489Ser]
1519 .. 1519 G/A rs147106698 - CDS Nonsynonymous[Asp493Asn]
1539 .. 1539 G/A rs144819608 - CDS Synonymous[Glu499Glu]
1583 .. 1583 A/T rs145240665 - CDS Nonsynonymous[Glu514Val]
1603 .. 1603 C/A rs183851032 - CDS Nonsynonymous[Pro521Thr]
1633 .. 1633 G/A rs201650598 - CDS Nonsynonymous[Val531Met]
1657 .. 1657 G/A rs150017851 - CDS Nonsynonymous[Ala539Thr]
1729 .. 1729 G/A rs199749953 - CDS Nonsynonymous[Val563Met]
1734 .. 1734 G/A rs141806544 - CDS Synonymous[Glu564Glu]
1796 .. 1796 C/T rs139973145 - CDS Nonsynonymous[Ala585Val]
1812 .. 1812 C/G rs17854840 - CDS Synonymous[Ser590Ser]
1813 .. 1813 G/C rs3813609 - CDS Nonsynonymous[Val591Leu]
1814 .. 1814 T/C rs149276784 - CDS Nonsynonymous[Val591Ala]
1821 .. 1821 C/T rs150907238 - CDS Synonymous[Ser593Ser]
1826 .. 1826 G/A rs113542444 - CDS Nonsynonymous[Gly595Asp]
1854 .. 1854 T/C rs139339322 - CDS Synonymous[Asn604Asn]
1898 .. 1898 T/C rs146914272 - CDS Nonsynonymous[Leu619Pro]
1957 .. 1957 G/A rs36089872 + CDS Nonsynonymous[Gly639Arg]
1973 .. 1973 C/G rs143582871 - CDS Nonsynonymous[Ala644Gly]
1987 .. 1987 G/A rs201625032 - CDS Nonsynonymous[Gly649Arg]
1991 .. 1991 A/G rs77801634 - CDS Nonsynonymous[Glu650Gly]
2043 .. 2043 C/T rs201140225 - CDS Synonymous[Gly667Gly]
2095 .. 2095 G/C rs147161320 - CDS Nonsynonymous[Glu685Gln]
2130 .. 2130 C/T rs137873621 - CDS Synonymous[Asp696Asp]
2131 .. 2131 G/A rs150721972 - CDS Nonsynonymous[Gly697Ser]
2142 .. 2142 C/G rs143839762 - CDS Nonsynonymous[Cys700Trp]
2190 .. 2190 T/G rs138976951 - CDS Synonymous[Thr716Thr]
2192 .. 2192 T/C rs200666764 - CDS Nonsynonymous[Leu717Pro]
2211 .. 2211 C/A rs141306456 - CDS Synonymous[Val723Val]
2212 .. 2212 C/T rs201641953 - CDS Nonsynonymous[Arg724Cys]
2214 .. 2214 C/T rs189945202 - CDS Synonymous[Arg724Arg]
2352 .. 2352 G/A rs61748975 - CDS Synonymous[Gly770Gly]
2420 .. 2420 C/T rs199790418 - CDS Nonsynonymous[Ala793Val]
2429 .. 2429 G/A rs140467510 - CDS Nonsynonymous[Arg796His]
2455 .. 2455 C/T rs140478074 - CDS Nonsynonymous[Arg805Trp]
2459 .. 2459 G/A rs112388093 - CDS Nonsynonymous[Arg806Gln]
2476 .. 2476 G/A rs201654812 - CDS Nonsynonymous[Glu812Lys]
2505 .. 2505 A/C rs144518416 - CDS Nonsynonymous[Arg821Ser]
2513 .. 2513 C/G rs149241760 - CDS Nonsynonymous[Pro824Arg]
2567 .. 2567 C/G/A rs150898288 - CDS
2597 .. 2597 G/A rs200017624 - CDS Nonsynonymous[Arg852Gln]
2659 .. 2659 C/T rs145113918 - CDS Nonsynonymous[Arg873Cys]
2664 .. 2664 A/G rs2774279 - CDS Synonymous[Arg874Arg]
2714 .. 2714 G/A rs145721081 - CDS Synonymous_atSTOP[*891*]
2775 .. 2775 T/G rs75570999 - 3'UTR
2780 .. 2780 A/C rs138342981 - 3'UTR
2818 .. 2818 A/G rs116809917 - 3'UTR
2821 .. 2821 C/T rs181884600 - 3'UTR
2827 .. 2827 G/A rs34034855 + 3'UTR
2839 .. 2839 C/A rs192492649 - 3'UTR
2898 .. 2898 C/T rs186700346 - 3'UTR
3116 .. 3116 C/T rs146499279 - 3'UTR
3138 .. 3138 A/G rs35251010 + 3'UTR
3231 .. 3231 G/A rs140408829 - 3'UTR
3251 .. 3251 G/A rs34040837 + 3'UTR
3322 .. 3322 G/C rs181969613 - 3'UTR
3330 .. 3330 C/T rs17215373 - 3'UTR
3373 .. 3373 G/A rs151217547 - 3'UTR
3409 ^ 3410 -/T rs36006634 - 3'UTR
3413 .. 3413 C/T rs142068425 - 3'UTR
3419 .. 3419 A/C rs17215366 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer