H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000054164 Accession number: BC056411 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Alpha/beta hydrolase domain-containing protein 14B; Abhydrolase domain-containing protein 14B; EC=3.-.-.-; CCG1-interacting factor B;
 
 

Transcript original information
Accession number BC056411.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:64912 IMAGE:6048106
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ABHD14B) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ABHD14B);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 1653[bp] (No. of exon:4)[A:325 T:373 G:427 C:528]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Skin, melanotic melanoma.
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1639(+) Signal: 1620-1624(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0215296
Genomic location  G-integra Help Chromosome 3
Location 3p21.2
Position 52002531- 52008047
Strand -
Possible duplicated location(s) NA
Gene structure 4 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:84836
KEGG GENES KEGG GENES(84836)
GeneCard GeneCardABHD14B*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000023792
Predicted CDS 96..728;  210[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.847
Database links RefSeq NP_001139786NP_116139
UniProt Q96IU4
CCDS CCDS2842

Motif information
ORF

length(210),orf(96:728)
MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQN
LGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDAL
ELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASV
KTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHT
GLLDFLQGLQ*
a.a.
length
InterPro Name
length(204), motif(5:208) 204 IPR029058 Alpha/Beta hydrolase fold [Domain]
length(205), motif(6:210) 205 IPR026764 Alpha/beta hydrolase domain-containing protein 14B [Family]
length(202), motif(7:208) 202 IPR029058 Alpha/Beta hydrolase fold [Domain]
length(154), motif(35:188) 154 IPR029059 Alpha/beta hydrolase fold-5 [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000054164
H-Inv cluster ID Locus viewHIX0215296
Accession number BC056411.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Alpha/beta hydrolase domain-containing protein 14B; Abhydrolase domain-containing protein 14B; EC=3.-.-.-; CCG1-interacting factor B;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q96IU4)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 1105385914672934147020391548933421269460ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ABHD14B
HGNC aliases NA
HGNC name abhydrolase domain containing 14B
DDBJ ABHD14B
UniProt ABHD14B
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000023792
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:84836
KEGG GENES KEGG GENES(84836)
GeneCard GeneCardABHD14B*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA


Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
2 209 1imjA 2e-77 100.0 208/208 c.69.1.23
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus NA
HG-U133 224821_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 224821_at; 
HG-U133_Plus_2 224821_at; 
HG-U95 45241_at; 
HG-U95A NA
HG-U95B 45241_at; 
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2623425;  2623427;  2675837;  2675838;  2675839;  2675840;  2675843;  2675844; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P155417; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P155417;  A_24_P337140; 
Related H-InvDB links H-ANGELH-ANGEL;  DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
117 .. 117 C/T rs141310936 - CDS Nonsynonymous[Arg8Cys]
144 .. 144 C/T rs114730569 - CDS AA-STOP[Gln17*]
148 .. 148 C/T rs202192380 - CDS Nonsynonymous[Ala18Val]
183 .. 183 C/T rs138434075 - CDS AA-STOP[Gln30*]
189 .. 189 C/T rs148936761 - CDS Nonsynonymous[Arg32Cys]
238 .. 238 G/C rs78631894 - CDS Nonsynonymous[Trp48Ser]
282 .. 282 C/T rs200722003 - CDS Nonsynonymous[Arg63Trp]
336 .. 336 C/T rs199563943 - CDS Nonsynonymous[Pro81Ser]
345 .. 345 A/G rs150276203 - CDS Nonsynonymous[Ile84Val]
357 .. 357 G/A rs202084346 - CDS Nonsynonymous[Ala88Thr]
404 .. 404 C/G rs146608830 - CDS Synonymous[Gly103Gly]
436 ^ 437 -/G rs34359997 - CDS
537 .. 537 G/A rs139689394 - CDS Nonsynonymous[Ala148Thr]
610 .. 610 T/C rs148406733 - CDS Nonsynonymous[Leu172Pro]
630 .. 630 C/T rs149746591 - CDS Nonsynonymous[Arg179Trp]
652 .. 652 C/T rs201010064 - CDS Nonsynonymous[Ala186Val]
688 .. 688 G/A rs202219876 - CDS AA-STOP[Trp198*]
735 .. 735 G/T rs13065840 - 3'UTR
759 .. 759 C/T rs11549093 + 3'UTR
779 .. 779 C/T rs112901597 - 3'UTR
826 .. 826 A/T rs141410429 - 3'UTR
877 .. 877 T/C rs139042255 - 3'UTR
892 .. 892 T/A rs146139089 - 3'UTR
953 .. 953 A/G rs142968135 - 3'UTR
1040 .. 1040 C/T rs191579484 - 3'UTR
1092 .. 1092 G/A rs2109636 + 3'UTR
1101 ^ 1102 -/C rs71889497 - 3'UTR
1226 .. 1226 T/G rs138386847 - 3'UTR
1252 .. 1252 G/C rs116629706 - 3'UTR
1291 .. 1291 G/A rs186340387 - 3'UTR
1325 .. 1325 C/A rs143091242 - 3'UTR
1487 .. 1487 A/C rs1059420 + 3'UTR
1495 .. 1495 G/A rs149492727 - 3'UTR
1518 .. 1518 C/T rs1059425 + 3'UTR
1527 .. 1527 C/T rs1059431 + 3'UTR
1531 ^ 1532 -/CCT rs60739587 - 3'UTR
1533 ^ 1534 -/CCT rs71779602 - 3'UTR
1535 ^ 1536 -/CTC rs16336 - 3'UTR
1557 .. 1557 C/T rs1059435 + 3'UTR
1580 .. 1580 C/T rs1059439 + 3'UTR
1600 .. 1600 G/A rs76508138 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer