H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000054164 Accession number: BC056411 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Alpha/beta hydrolase domain-containing protein 14B; Abhydrolase domain-containing protein 14B; EC=3.-.-.-; CCG1-interacting factor B;
 
 

Motif information
ORF

length(210),orf(96:728)
MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQN
LGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDAL
ELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASV
KTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHT
GLLDFLQGLQ*
a.a.
length
InterPro Name
length(204), motif(5:208) 204 IPR029058 Alpha/Beta hydrolase fold [Domain]
length(205), motif(6:210) 205 IPR026764 Alpha/beta hydrolase domain-containing protein 14B [Family]
length(202), motif(7:208) 202 IPR029058 Alpha/Beta hydrolase fold [Domain]
length(154), motif(35:188) 154 IPR029059 Alpha/beta hydrolase fold-5 [Domain]