H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000061687 Accession number: AF002668 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Sphingolipid delta(4)-desaturase DES1; EC=1.14.-.-; Cell migration-inducing gene 15 protein; Degenerative spermatocyte homolog 1; Membrane lipid desaturase;
 
 

Motif information
ORF

length(323),orf(72:1043)
MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMM
VLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNC
KAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVDVDIPTDFEG
WFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILI
YYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLN
LLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDF
VMDDTISPYSRMKRHQKGEMVLE*
a.a.
length
InterPro Name
length(38), motif(5:42) 38 IPR013866 Sphingolipid delta4-desaturase, N-terminal [Domain]
length(218), motif(68:285) 218 IPR005804 Fatty acid desaturase, type 1 [Domain]