H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000066197 Accession number: AF076844 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Checkpoint protein HUS1; hHUS1;
 
 

Transcript original information
Accession number AF076844.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (HUS1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (HUS1);
Sequence data provider NA
Annotation project NA
Length of cDNA 2124[bp] (No. of exon:9)[A:548 T:603 G:462 C:511]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) TAGGAG; 
Transcript quality feature NMD predicted; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0006675
Genomic location  G-integra Help Chromosome 7
Location 7p12.3
Position 47998602- 48019178
Strand -
Possible duplicated location(s) NA
Gene structure 9 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3364
KEGG GENES KEGG GENES(3364)
GeneCard GeneCardHUS1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000066958
Predicted CDS 64..906;  280[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.724
Database links RefSeq NP_004498
UniProt O60921
CCDS CCDS34635

Motif information
ORF

length(280),orf(64:906)
MKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANG
GVSMWCELEQENFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARA
LKIKLTNKHFPCLTVSVELLSMSSSSRIVTHDIPIKVIPRKLWKDLQEPV
VPDPDVSIYLPVLKTMKSVVEKMKNISNHLVIEANLDGELNLKIETELVC
VTTHFKDLGNPPLASESTHEDRNVEHMAEVHIDIRKLLQFLAGQQVNPTK
ALCNIVNNKMVHFDLLHEDVSLQYFIPALS*
a.a.
length
InterPro Name
length(279), motif(1:279) 279 IPR007150 Checkpoint protein Hus1/Mec3 [Family]
length(280), motif(1:280) 280 IPR007150 Checkpoint protein Hus1/Mec3 [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000066197
H-Inv cluster ID Locus viewHIX0006675
Accession number AF076844.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript; 
Coding potential  Help Protein coding; 
Definition Checkpoint protein HUS1; hHUS1;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (O60921)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 9524127987824510359610107776621084617010884395110774461157395512578958145003601461180615314187154893341555699615871698158978951621627321659603ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol HUS1
HGNC aliases "HUS1 (S. pombe) checkpoint homolog"
HGNC name HUS1 checkpoint homolog (S. pombe)
DDBJ HUS1
UniProt HUS1
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000066958
No. of interaction 26
Interaction partner(s) HIP000017793HIP000021982HIP000022009HIP000023019HIP000027496HIP000029673HIP000029673HIP000035818HIP000038659HIP000040764HIP000041413HIP000044897HIP000059017HIP000059017HIP000062997HIP000069004HIP000071068HIP000079993HIP000082878HIP000092109HIP000092959HIP000134584HIP000134584HIP000146711HIP000256099HIP000258134
BIND 185472; 
DIP 113190E;  116037E;  116738E;  117084E;  117312E; 
MINT MINT-3318251; 
HPRD 01124;  01456;  01565;  01566;  01972;  02388;  03143;  03183;  04400;  04788;  05816;  07046;  08907;  09085;  09124;  12221;  13722; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3364
KEGG GENES KEGG GENES(3364)
GeneCard GeneCardHUS1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Biological process DNA repair (GO:0006281);  DNA damage checkpoint (GO:0000077); 
Cellular component checkpoint clamp complex (GO:0030896); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear;  mitochondria;  Other; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
3 111 1plqA1 9e-11 15.5 97/126 d.131.1.2
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA201307; 
Affymetrix
GeneChip
HG-Focus 204884_s_at; 
HG-U133 204883_s_at;  204884_s_at; 
HG-U133A 204883_s_at;  204884_s_at; 
HG-U133A_2 204883_s_at;  204884_s_at; 
HG-U133B NA
HG-U133_Plus_2 204883_s_at;  204884_s_at; 
HG-U95 38153_at;  80446_at; 
HG-U95A 38153_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E 80446_at; 
HG-U95Av2 NA
HuEx-1_0 3000926;  3049844;  3049845;  3049849;  3049850;  3049852;  3049855;  3049858;  3049859;  3049861;  3049862;  3049864;  3049865; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_23_P156977; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Mus sp. (Mouse) AK135922 G-integraG-integra
Orthology Bos sp. (Cow) ENSBTAT00000017599 G-integraG-integra
Orthology Danio sp. (Zebrafish) ENSDART00000087478 G-integraG-integra
Orthology Equus sp. (Horse) ENSECAT00000014671 G-integraG-integra
Orthology Gallus sp. (Chicken) ENSGALT00000020352 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000004358 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000029300 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00025281001 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000180912 G-integraG-integra
Orthology Rattus sp. (Rat) XM_001054510 G-integraG-integra
Orthology Macaca sp. (Macaque) XM_001088000 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001367356 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XM_519090 G-integraG-integra
Orthology Canis sp. (Dog) XM_843198 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
21 .. 21 C/T rs200249102 - 5'UTR
57 .. 57 C/T rs200785968 - 5'UTR
73 .. 73 C/T rs138248432 - CDS Nonsynonymous[Arg4Trp]
82 .. 82 A/G rs2307255 + CDS Nonsynonymous[Ile7Val]
91 .. 91 G/T rs202090804 - CDS Nonsynonymous[Gly10Trp]
106 .. 106 C/T rs145887588 - CDS Nonsynonymous[His15Tyr]
114 .. 114 A/G rs2307257 + CDS Synonymous[Thr17Thr]
153 .. 153 C/T rs2307253 + CDS Synonymous[Cys30Cys]
190 .. 190 C/T rs28910274 + CDS Nonsynonymous[Leu43Phe]
194 .. 194 G/A rs200244554 - CDS Nonsynonymous[Cys44Tyr]
223 .. 223 A/G rs11551144 + CDS Nonsynonymous[Met54Val]
267 .. 267 A/G/C rs142407794 - CDS
317 .. 317 C/T rs202060328 - CDS Nonsynonymous[Ser85Leu]
319 .. 319 G/A rs201091914 - CDS Nonsynonymous[Glu86Lys]
365 .. 365 T/C rs149049902 - CDS Nonsynonymous[Leu101Ser]
395 .. 395 C/A rs200875322 - CDS Nonsynonymous[Pro111His]
405 .. 405 G/A rs144957790 - CDS Synonymous[Thr114Thr]
411 .. 411 C/G rs145160524 - CDS Synonymous[Ser116Ser]
418 .. 418 C/T rs139437649 - CDS Synonymous[Leu119Leu]
439 .. 439 A/G rs2307261 + CDS Nonsynonymous[Ser126Gly]
462 .. 462 C/A rs201062463 - CDS Synonymous[Ile133Ile]
502 .. 502 C/A rs2307254 + CDS Nonsynonymous[Gln147Lys]
516 .. 516 C/T rs2307249 + CDS Synonymous[Val151Val]
559 .. 559 A/G rs139623972 - CDS Nonsynonymous[Met166Val]
588 .. 588 C/T rs150551899 - CDS Synonymous[Asn175Asn]
650 .. 650 C/G rs138848570 - CDS Nonsynonymous[Thr196Ser]
726 .. 726 C/G rs3176588 + CDS Nonsynonymous[Asp221Glu]
750 .. 750 A/C rs200031230 - CDS Nonsynonymous[Glu229Asp]
817 .. 817 T/A rs79656108 - CDS Nonsynonymous[Leu252Ile]
820 .. 820 T/C rs199759985 - CDS Nonsynonymous[Cys253Arg]
859 .. 859 C/T rs200372941 - CDS Nonsynonymous[Leu266Phe]
868 .. 868 G/A rs10253916 - CDS Nonsynonymous[Asp269Asn]
897 .. 897 G/A rs1056663 + CDS Synonymous[Ala278Ala]
915 .. 915 C/T rs201035634 - 3'UTR
957 .. 957 C/T rs3176608 + 3'UTR
1001 .. 1001 C/T rs114754011 - 3'UTR
1056 .. 1056 G/A rs77988320 - 3'UTR
1088 .. 1088 A/G rs186980160 - 3'UTR
1157 .. 1157 T/C rs142997403 - 3'UTR
1200 .. 1200 G/A rs183344163 - 3'UTR
1263 .. 1263 C/T rs111922480 - 3'UTR
1297 .. 1297 G/A rs3176609 + 3'UTR
1305 .. 1305 C/T rs3176610 + 3'UTR
1342 ^ 1343 -/T rs3176611 + 3'UTR
1343 ^ 1344 -/T rs72565166 - 3'UTR
1510 .. 1510 A/G rs192452261 - 3'UTR
1514 .. 1514 C/T rs3176612 + 3'UTR
1531 .. 1531 G/A rs150443392 - 3'UTR
1590 .. 1590 G/A rs140610086 - 3'UTR
1894 .. 1894 G/A rs111416166 - 3'UTR
1939 .. 1939 G/A rs151316494 - 3'UTR
1973 .. 1973 C/T rs139439438 - 3'UTR
2000 ^ 2001 -/G rs35927427 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
AluJr 1863 2076 -
FLAM_A 2077 2120 +
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer