H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000066197 Accession number: AF076844 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Checkpoint protein HUS1; hHUS1;
 
 

Motif information
ORF

length(280),orf(64:906)
MKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANG
GVSMWCELEQENFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARA
LKIKLTNKHFPCLTVSVELLSMSSSSRIVTHDIPIKVIPRKLWKDLQEPV
VPDPDVSIYLPVLKTMKSVVEKMKNISNHLVIEANLDGELNLKIETELVC
VTTHFKDLGNPPLASESTHEDRNVEHMAEVHIDIRKLLQFLAGQQVNPTK
ALCNIVNNKMVHFDLLHEDVSLQYFIPALS*
a.a.
length
InterPro Name
length(279), motif(1:279) 279 IPR007150 Checkpoint protein Hus1/Mec3 [Family]
length(280), motif(1:280) 280 IPR007150 Checkpoint protein Hus1/Mec3 [Family]