H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000066218 Accession number: AF077301 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Beclin-1; Coiled-coil myosin-like BCL2-interacting protein; Protein GT197;
 
 

Transcript original information
Accession number AF077301.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (BECN1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (BECN1);
Sequence data provider NA
Annotation project NA
Length of cDNA 1353[bp] (No. of exon:11)[A:387 T:293 G:372 C:301]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type normalized brain
Develpmental stage infant
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG; 
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0018211
Genomic location  G-integra Help Chromosome 17
Location 17q21.31
Position 40962778- 40975895
Strand -
Possible duplicated location(s) NA
Gene structure 11 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:8678
KEGG GENES KEGG GENES(8678)
GeneCard GeneCardBECN1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000046736
Predicted CDS 1..1353;  450[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.802
Database links RefSeq NP_003757
UniProt Q14457
CCDS CCDS11441

Motif information
ORF

length(450),orf(1:1353)
MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTA
QAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLI
GEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDT
QLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELED
VEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSV
ENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW
NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELP
LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEK
GKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK
*
a.a.
length
InterPro Name
length(444), motif(7:450) 444 IPR007243 Atg6/Beclin [Family]
length(25), motif(105:129) 25 IPR029318 Beclin-1, BH3 domain [Domain]
length(315), motif(135:449) 315 IPR007243 Atg6/Beclin [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000066218
H-Inv cluster ID Locus viewHIX0018211
Accession number AF077301.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Beclin-1; Coiled-coil myosin-like BCL2-interacting protein; Protein GT197;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q14457)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 749009197653971039580015489334173374441765930217724469186919761884305219050071191801161927069619369195202085302196251822205736ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol BECN1
HGNC aliases "beclin 1 (coiled-coil, moesin-like BCL2 interacting protein)"
HGNC name beclin 1, autophagy related
DDBJ NA
UniProt BECN1
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000046736
No. of interaction 28
Interaction partner(s) HIP000021401HIP000022280HIP000025405HIP000027204HIP000031372HIP000031550HIP000032180HIP000033751HIP000034060HIP000035113HIP000037549HIP000046115HIP000046905HIP000056882HIP000064131HIP000067426HIP000072110HIP000074716HIP000074716HIP000077989HIP000090248HIP000096010HIP000100490HIP000102198HIP000114869HIP000115321HIP000115509HIP000349364
BIND NA
DIP 103350E;  103353E;  103355E;  103425E;  103426E;  103427E;  111658E;  144892E;  144895E;  75621E; 
MINT MINT-2865463;  MINT-4820784;  MINT-4821014;  MINT-4821036;  MINT-7014496;  MINT-7014531;  MINT-7014553;  MINT-7014569;  MINT-7014585;  MINT-7712827;  MINT-7968986;  MINT-7969161;  MINT-7969366;  MINT-8095181;  MINT-8095190;  MINT-8095201;  MINT-8095220;  MINT-8182780;  MINT-8198040;  MINT-8198947;  MINT-8198977; 
HPRD 00169;  00721;  00753;  01045;  01177;  01178;  01550;  02077;  02497;  02658;  02744;  02902;  02941;  03135;  03380;  03671;  03929;  03975;  04009;  04010;  05088;  05205;  05594;  05829;  06024;  07029;  07304;  08540;  09943;  10562;  10975;  11401;  15183;  15333;  15334;  16051;  17929; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:8678
KEGG GENES KEGG GENES(8678)
GeneCard GeneCardBECN1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Biological process autophagy (GO:0006914); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear;  mitochondria;  Other; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Twilight zone
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus NA
HG-U133 208945_s_at; 
HG-U133A 208945_s_at; 
HG-U133A_2 208945_s_at; 
HG-U133B NA
HG-U133_Plus_2 208945_s_at; 
HG-U95 NA
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3722149;  3758164;  3758169;  3758172;  3758175;  3758176;  3758177;  3758180;  3758185;  3758188;  3758190; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_24_P313597; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
68 .. 68 A/T rs144217377 - CDS Nonsynonymous[Gln23Leu]
102 .. 102 G/A rs149327456 - CDS Synonymous[Leu34Leu]
156 .. 156 G/A rs200641576 - CDS Synonymous[Ala52Ala]
193 .. 193 G/T rs113316728 - CDS AA-STOP[Gly65*]
207 .. 207 T/A rs199562786 - CDS Nonsynonymous[Phe69Leu]
220 .. 220 C/T rs201863805 - CDS Nonsynonymous[Arg74Cys]
221 .. 221 G/A rs200813134 - CDS Nonsynonymous[Arg74His]
225 .. 225 G/A rs199603878 - CDS Synonymous[Gln75Gln]
339 .. 339 C/A rs80236238 - CDS Nonsynonymous[Ser113Arg]
348 .. 348 G/T rs201947039 - CDS Synonymous[Leu116Leu]
459 .. 459 C/T rs111283520 - CDS Synonymous[Asn153Asn]
471 .. 471 T/C rs111762474 - CDS Synonymous[Asn157Asn]
490 .. 490 C/T rs147205679 - CDS Nonsynonymous[Arg164Cys]
496 .. 496 T/G rs143622099 - CDS Nonsynonymous[Leu166Val]
614 .. 614 G/C/A rs141389235 - CDS
637 .. 637 G/C rs201722661 - CDS Nonsynonymous[Glu213Gln]
658 .. 658 G/A rs138937709 - CDS Nonsynonymous[Glu220Lys]
664 .. 664 C/T rs199808010 - CDS Synonymous[Leu222Leu]
681 .. 681 T/A rs77552925 - CDS Synonymous[Ala227Ala]
743 .. 743 A/G rs148197780 - CDS Nonsynonymous[Lys248Arg]
763 .. 763 C/T rs143018406 - CDS Nonsynonymous[Arg255Cys]
774 .. 774 G/T rs34128114 - CDS Nonsynonymous[Gln258His]
916 .. 916 G/T rs200971735 - CDS Nonsynonymous[Ala306Ser]
978 .. 978 G/T rs149225760 - CDS Nonsynonymous[Gln326His]
999 .. 999 C/T rs146634471 - CDS Synonymous[Tyr333Tyr]
1075 .. 1075 T/A rs144442407 - CDS Nonsynonymous[Phe359Ile]
1116 .. 1116 C/T rs140668306 - CDS Synonymous[Phe372Phe]
1245 ^ 1246 -/C rs142991093 - CDS
1308 .. 1308 T/G rs1802429 + CDS Synonymous[Leu436Leu]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer