H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000066218 Accession number: AF077301 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Beclin-1; Coiled-coil myosin-like BCL2-interacting protein; Protein GT197;
 
 

Motif information
ORF

length(450),orf(1:1353)
MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTA
QAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLI
GEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDT
QLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELED
VEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSV
ENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW
NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELP
LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEK
GKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK
*
a.a.
length
InterPro Name
length(444), motif(7:450) 444 IPR007243 Atg6/Beclin [Family]
length(25), motif(105:129) 25 IPR029318 Beclin-1, BH3 domain [Domain]
length(315), motif(135:449) 315 IPR007243 Atg6/Beclin [Family]