H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000074248 Accession number: AF218003 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Chaperone activity of bc1 complex-like, mitochondrial; Chaperone-ABC1-like; EC=2.7.11.-; aarF domain-containing protein kinase 3; Precursor;
 
 

Transcript original information
Accession number AF218003.1
CAGE tag ID NA
EST ID NA
Clone Number PP265
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ADCK3) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ADCK3);
Sequence data provider NA
Annotation project NA
Length of cDNA 1969[bp] (No. of exon:7)[A:438 T:430 G:574 C:527]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N-truncated
Kozak sequence NA
PolyA Site: 1938(+) Signal: 1914-1918(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001648
Genomic location  G-integra Help Chromosome 1
Location 1q42.13
Position 227170708- 227175245
Strand +
Possible duplicated location(s) NA
Gene structure 7 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:56997
KEGG GENES KEGG GENES(56997)
GeneCard GeneCardADCK3*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000394394
Predicted CDS 169..1131;  320[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.83

Motif information
ORF

length(320),orf(169:1131)
LPARGRLCPQVQVWPPAGPLACLHQGGRRDHVQQLVKAPPALRGRGLGLQ
PGPRPYPAWGEGGPSAWLGGVCGGGDGVEGLWLGRDLPPLPRDLLKGHPF
FYVPEIVDELCSPHVLTTELVSGFPLDQAEGLSQEIRNEICYNILVLCLR
ELFEFHFMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQIIR
AAADRDRETVRAKSIEMKFLTGYEVKVMEDAHLDAILILGEAFASDEPFD
FGTQSTTEKIHNLIPVMLRHRLVPPPEETYSLHRKMGGSFLICSKLKARF
PCKAMFEEAYSNYCKRQAQQ*
a.a.
length
InterPro Name
length(93), motif(100:192) 93 IPR011009 Protein kinase-like domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000074248
H-Inv cluster ID Locus viewHIX0001648
Accession number AF218003.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Chaperone activity of bc1 complex-like, mitochondrial; Chaperone-ABC1-like; EC=2.7.11.-; aarF domain-containing protein kinase 3; Precursor;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (Q8NI60)  [Identity/coverage = 100.0%/35.39%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 11888884147020391548933415498874167104141734484617974005183190721831907421269460ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ADCK3
HGNC aliases "chaperone-ABC1 (activity of bc1 complex, S.pombe)-like", "chaperone, ABC1 activity of bc1 complex like (S. pombe)", "chaperone, ABC1 activity of bc1 complex homolog (S. pombe)"
HGNC name aarF domain containing kinase 3
DDBJ NA
UniProt ADCK3
EC number EC 2.7.11.-Protein-serine/threonine kinases; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000394394
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:56997
KEGG GENES KEGG GENES(56997)
GeneCard GeneCardADCK3*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function transferase activity, transferring phosphorus-containing groups (GO:0016772); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  mitochondria;  nuclear;  Other; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA241008; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 218168_s_at; 
HG-U133A 218168_s_at; 
HG-U133A_2 218168_s_at; 
HG-U133B NA
HG-U133_Plus_2 218168_s_at; 
HG-U95 45334_at;  64312_at; 
HG-U95A NA
HG-U95B 45334_at; 
HG-U95C 64312_at; 
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2383411;  2383413;  2383416;  2383419;  2383420;  2383421;  2383422;  2383424;  2383425;  2459040; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_23_P85598; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
1 .. 1 C/T rs55958233 + 5'UTR
37 .. 37 C/T rs139570869 + 5'UTR
56 .. 56 A/G rs180784380 + 5'UTR
68 .. 68 A/C rs146751657 + 5'UTR
133 .. 133 C/T rs17849927 + 5'UTR
136 .. 136 C/T rs139133094 + 5'UTR
141 .. 141 T/C rs199921339 + 5'UTR
163 .. 163 G/A rs149048093 + 5'UTR
194 .. 194 C/T rs151292389 + CDS Nonsynonymous[Pro9Leu]
199 .. 199 G/A rs202227926 + CDS Nonsynonymous[Val11Ile]
220 .. 220 G/A rs185185707 + CDS Nonsynonymous[Gly18Arg]
234 .. 234 T/- rs3215919 + CDS
240 .. 240 C/A rs200965287 + CDS Nonsynonymous[His24Gln]
244 .. 244 G/A rs149505935 + CDS Nonsynonymous[Gly26Arg]
384 ^ 385 -/T rs149374145 + CDS
386 .. 386 G/T rs1574184 + CDS Nonsynonymous[Gly73Val]
387 ^ 388 -/T rs201300405 + CDS
388 .. 388 G/C/T rs1574185 + CDS
435 .. 435 C/T rs200440257 + CDS Synonymous[Pro89Pro]
445 .. 445 G/A rs147097934 + CDS Nonsynonymous[Asp93Asn]
451 .. 451 C/T rs200375779 + CDS Synonymous[Leu95Leu]
473 .. 473 A/G rs144147839 + CDS Nonsynonymous[Tyr102Cys]
519 .. 519 C/T rs138727410 + CDS Synonymous[Thr117Thr]
565 .. 565 A/G rs149364914 + CDS Nonsynonymous[Ser133Gly]
577 .. 577 C/T rs139900636 + CDS Nonsynonymous[Arg137Trp]
583 .. 583 G/A rs201134290 + CDS Nonsynonymous[Glu139Lys]
596 .. 596 A/G rs200800365 + CDS Nonsynonymous[Asn143Ser]
609 .. 609 G/A rs202132812 + CDS Synonymous[Leu147Leu]
617 .. 617 G/- rs34158214 + CDS
627 .. 627 C/T rs12593 - CDS Synonymous[Phe153Phe]
666 .. 666 C/A rs150918577 + CDS Nonsynonymous[Asn166Lys]
720 .. 720 G/A rs201337210 + CDS Synonymous[Thr184Thr]
721 .. 721 C/T rs149682899 + CDS Nonsynonymous[Arg185Trp]
722 .. 722 G/A rs200115323 + CDS Nonsynonymous[Arg185Gln]
728 .. 728 A/G rs119468008 + CDS Nonsynonymous[Tyr187Cys]
743 .. 743 C/G rs141260985 + CDS Nonsynonymous[Thr192Ser]
754 .. 754 A/G rs147730489 + CDS Nonsynonymous[Ile196Val]
778 .. 778 G/A rs200930703 + CDS Nonsynonymous[Asp204Asn]
792 .. 792 G/C rs201158713 + CDS Nonsynonymous[Glu208Asp]
793 .. 793 A/G rs200403220 + CDS Nonsynonymous[Thr209Ala]
797 .. 797 T/G rs199724504 + CDS Nonsynonymous[Val210Gly]
799 .. 799 C/T rs201331131 + CDS Nonsynonymous[Arg211Trp]
804 .. 804 G/A rs142600066 + CDS Synonymous[Ala212Ala]
831 .. 831 C/T rs141423403 + CDS Synonymous[Thr221Thr]
832 .. 832 G/A rs119468009 + CDS Nonsynonymous[Gly222Ser]
838 .. 838 G/A rs119468004 + CDS Nonsynonymous[Glu224Lys]
852 .. 852 G/A rs199874519 + CDS Nonsynonymous[Met228Ile]
859 .. 859 G/A rs142894121 + CDS Nonsynonymous[Ala231Thr]
864 .. 864 C/G rs200963031 + CDS Nonsynonymous[His232Gln]
897 .. 897 C/T rs139305619 + CDS Synonymous[Phe243Phe]
903 .. 903 T/C rs3738725 + CDS Synonymous[Ser245Ser]
907 .. 907 G/A rs202058665 + CDS Nonsynonymous[Glu247Lys]
926 .. 926 C/T rs199581236 + CDS Nonsynonymous[Thr253Ile]
939 .. 939 C/T rs201865243 + CDS Synonymous[Thr257Thr]
942 .. 942 G/C rs201171077 + CDS Nonsynonymous[Glu258Asp]
944 .. 944 A/G rs113308613 + CDS Nonsynonymous[Lys259Arg]
952 .. 952 A/C rs142051104 + CDS Nonsynonymous[Asn262His]
963 .. 963 C/T rs7545723 + CDS Synonymous[Pro265Pro]
984 .. 984 C/T rs139551241 + CDS Synonymous[Leu272Leu]
987 .. 987 C/G rs74589348 + CDS Synonymous[Val273Val]
992 .. 992 C/A/G rs61995958 + CDS
1003 .. 1003 A/C rs143650593 + CDS Nonsynonymous[Thr279Pro]
1008 .. 1008 C/T rs201618750 + CDS Synonymous[Tyr280Tyr]
1011 .. 1011 C/T rs141270350 + CDS Synonymous[Ser281Ser]
1053 .. 1053 G/A rs191944347 + CDS Synonymous[Lys295Lys]
1063 .. 1063 C/T rs141725964 + CDS Nonsynonymous[Arg299Cys]
1086 .. 1086 C/T rs150569155 + CDS Synonymous[Phe306Phe]
1087 .. 1087 G/A rs149335528 + CDS Nonsynonymous[Glu307Lys]
1101 .. 1101 C/T rs56043893 + CDS Synonymous[Ser311Ser]
1140 .. 1140 G/A rs200743857 + 3'UTR
1264 .. 1264 G/A rs149820067 + 3'UTR
1361 .. 1361 G/A rs117808661 + 3'UTR
1365 .. 1365 G/A rs188462608 + 3'UTR
1480 .. 1480 G/A rs113041399 + 3'UTR
1514 .. 1514 G/A rs113631619 + 3'UTR
1515 .. 1515 A/T rs112529851 + 3'UTR
1515 ^ 1516 -/T rs11420839 + 3'UTR
1519 ^ 1520 -/T rs199664948 + 3'UTR
1573 .. 1573 C/G rs12567953 + 3'UTR
1594 .. 1594 A/G rs8159 - 3'UTR
1639 .. 1639 G/A rs142056615 + 3'UTR
1773 .. 1773 G/A rs115542970 + 3'UTR
1786 .. 1786 G/A rs181352749 + 3'UTR
1811 .. 1811 A/G rs10482 - 3'UTR
1857 .. 1857 C/T rs16846762 + 3'UTR
1891 .. 1891 G/A rs145779574 + 3'UTR
1920 .. 1920 A/G rs12565212 + 3'UTR
1937 ^ 1938 -/T rs140711993 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer