H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000077788 Accession number: AF334386 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: U3 small nucleolar RNA-associated protein 6 homolog; Hepatocellular carcinoma-associated antigen 66; Multiple hat domains protein;
 
 

Motif information
ORF

length(597),orf(97:1890)
MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYKIQRRTLF
KEDFINYVQYEINLLELIQRRRTRIGYSFKKDEIENSIVHRVQGVFQRAS
AKWKDDVQLWLSYVAFCKKWATKTRLSKVFSAMLAIHSNKPALWIMAAKW
EMEDRLSSESARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEF
EKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFD
FAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAV
EVGRKEERCCAVYEEAVKTLPTEAMWKCYITFCLERFTKKSNSGFLRGKR
LERTMTVFRKAHELKLLSECQYKQLSVSLLCYNFLREALEVAVAGTELFR
DSGTMWQLKLQVLIESKSPDIAMLFEEAFVHLKPQVCLPLWISWAEWSEG
AKSQEDTEAVFKKALLAVIGADSVTLKNKYLDWAYRSGGYKKARAVFKSL
QESRPFSVDFFRKMIQFEKEQESCNMANIREYYERALREFGSADSDLWMD
YMKEELNHPLGRPENCGQIYWRAMKMLQGESAEAFVAKHAMHQTGHL*
a.a.
length
InterPro Name
length(84), motif(9:92) 84 IPR013949 U3 small nucleolar RNA-associated protein 6 [Domain]
length(33), motif(87:119) 33 IPR003107 HAT (Half-A-TPR) repeat [Repeat]
length(33), motif(121:153) 33 IPR003107 HAT (Half-A-TPR) repeat [Repeat]
length(65), motif(128:192) 65 IPR011990 Tetratricopeptide-like helical domain [Domain]
length(33), motif(156:188) 33 IPR003107 HAT (Half-A-TPR) repeat [Repeat]
length(32), motif(304:335) 32 IPR003107 HAT (Half-A-TPR) repeat [Repeat]
length(168), motif(371:538) 168 IPR011990 Tetratricopeptide-like helical domain [Domain]
length(35), motif(452:486) 35 IPR003107 HAT (Half-A-TPR) repeat [Repeat]
length(33), motif(488:520) 33 IPR003107 HAT (Half-A-TPR) repeat [Repeat]
length(34), motif(524:557) 34 IPR003107 HAT (Half-A-TPR) repeat [Repeat]