H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000081405 Accession number: AF534078 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Zinc finger protein 638 isoform 2.
 
 

Transcript original information
Accession number AF534078.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ZNF638) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ZNF638);
Sequence data provider NA
Annotation project NA
Length of cDNA 4075[bp] (No. of exon:26)[A:1427 T:1026 G:859 C:763]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type testis
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG;  TAGAAG; 
Transcript quality feature NMD predicted;  Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0215177
Genomic location  G-integra Help Chromosome 2
Location 2p13.2
Position 71576082- 71661937
Strand +
Possible duplicated location(s) NA
Gene structure 26 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:27332
KEGG GENES KEGG GENES(27332)
GeneCard GeneCardZNF638*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000102216
Predicted CDS 4..3423;  1139[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.692

Motif information
ORF

length(1139),orf(4:3423)
MSRPRFNPRGDFPLQRPRAPNPSGMRPPGPFMRPGSMGLPRFYPAGRARG
IPHRFAGHESYQNMGPQRMNVQVTQHRTDPRLTKEKLDFHEAQQKKGKPH
GSRWDDEPHISASVAVKQSSVTQVTEQSPKVQSRYTKESASSILASFGLS
NEDLEELSRYPDEQLTPENMPLILRDIRMRKMGRRLPNLPSQSRNKETLG
SEAVSSNVVDYGHASKYGYTEDPLEVRIYDPEIPTDEVENEFQSQQNISA
SVPNPNVICNSMFPVEDVFRQMDFPGESSNNRSFFSVESGTKMSGLHISG
GQSVLEPIKSVNQSINQTVSQTMSQSLIPPSMNQQPFSSELISSVSQQER
IPHEPVINSSNVHVGSRGSKKNYQSQADIPIRSPFGIVKASWLPKFSHAD
AQKMKRLPTPSMMNDYYAASPRIFPHLCSLCNVECSHLKDWIQHQNTSTH
IESCRQLRQQYPDWNPEILPSRRNEGNRKENETPRRRSHSPSPRRSRRSS
SSHRFRRSRSPMHYMYRPRSRSPRICHRFISRYRSRSRSRSPYRIRNPFR
GSPKCFRSVSPERMSRRSVRSSDRKKALEDVVQRSGHGTEFNKQKHLEAA
DKGHSPAQKPKTSSGTKPSVKPTSATKSDSNLGGHSIRCKSKNLEDDTLS
ECKQVSDKAVSLQRKLRKEQSLHYGSVLLITELPEDGCTEEDVRKLFQPF
GKVNDVLIVPYRKEAYLEMEFKEAITAIMKYIETTPLTIKGKSVKICVPG
KKKAQNKEVKKKTLESKKVSASTLKRDADASKAVEIVTSTSAAKTGQAKA
SVAKVNKSTGKSASSVKSVVTVAVKGNKASIKTAKSGGKKSLEAKKTGNV
KNKDSNKPVTIPENSEIKTSIEVKATENCAKEAISDAALEATENEPLNKE
TEEMCVMLVSNLPNKGYSVEEVYDLAKPFGGLKDILILSSHKKAYIEINR
KAAESMVKFYTCFPVLMDGNQLSISMAPENMNIKDEEAIFITLVKENDPE
...
a.a.
length
InterPro Name
length(25), motif(426:450) 25 IPR015880 Zinc finger, C2H2-like [Domain]
length(92), motif(667:758) 92 IPR012677 Nucleotide-binding alpha-beta plait domain [Domain]
length(71), motif(676:746) 71 IPR000504 RNA recognition motif domain [Domain]
length(71), motif(677:747) 71 IPR000504 RNA recognition motif domain [Domain]
length(86), motif(898:983) 86 IPR012677 Nucleotide-binding alpha-beta plait domain [Domain]
length(84), motif(998:1081) 84 IPR012677 Nucleotide-binding alpha-beta plait domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000081405
H-Inv cluster ID Locus viewHIX0215177
Accession number AF534078.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Zinc finger protein 638 isoform 2.
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (NP_001239542)  [Identity/coverage = 83.521%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ZNF638
HGNC aliases "zinc finger, matrin-like"
HGNC name zinc finger protein 638
DDBJ NP220
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000102216
No. of interaction 11
Interaction partner(s) HIP000014863HIP000022029HIP000022647HIP000054449HIP000054449HIP000111177HIP000165735HIP000165735HIP000179460HIP000326817HIP000326817
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:27332
KEGG GENES KEGG GENES(27332)
GeneCard GeneCardZNF638*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
FR ID FR300159
Accession
Description
Location
PMID

Gene ontology information
Molecular function nucleic acid binding (GO:0003676);  nucleotide binding (GO:0000166); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
425 460 1zr9A1 2e-04 19.4 36/67 g.37.1.4
677 746 1sjqA 3e-06 33.3 69/88 d.58.7.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsB221004; 
Affymetrix
GeneChip
HG-Focus 213775_x_at; 
HG-U133 211257_x_at;  213775_x_at; 
HG-U133A 211257_x_at;  213775_x_at; 
HG-U133A_2 211257_x_at;  213775_x_at; 
HG-U133B NA
HG-U133_Plus_2 1554249_a_at;  211257_x_at;  213775_x_at; 
HG-U95 32674_at; 
HG-U95A 32674_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2488139;  2488140;  2488146;  2488149;  2488150;  2488151;  2488153;  2488154;  2488155;  2488156;  2488160;  2488161;  2488181;  2488184;  2488185;  2488187;  2488189;  2488193;  2488194;  2488195;  2488196;  2488197;  2488199;  2488207;  2488212;  2488214;  2488215;  2488219;  2488223;  2488226;  2488227;  2488232;  2559056; 
HuGeneFL D83032_at; 
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_24_P419177; 
Related H-InvDB links H-ANGELH-ANGEL;  DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
2 .. 2 C/T rs140659649 + 5'UTR
29 .. 29 G/A rs202042555 + CDS Nonsynonymous[Arg9Gln]
43 .. 43 C/T rs143340083 + CDS Nonsynonymous[Leu14Phe]
82 .. 82 C/T rs61344341 + CDS Nonsynonymous[Pro27Ser]
91 .. 91 C/T rs148746042 + CDS Nonsynonymous[Pro30Ser]
104 .. 104 C/A rs141395815 + CDS Nonsynonymous[Pro34His]
112 .. 112 A/G rs139959335 + CDS Nonsynonymous[Met37Val]
136 .. 136 G/T rs146722075 + CDS Nonsynonymous[Ala45Ser]
139 .. 139 G/- rs35601433 + CDS
148 .. 148 C/T rs149932567 + CDS Nonsynonymous[Arg49Cys]
151 ^ 152 -/G rs35950410 + CDS
228 .. 228 A/G rs142437672 + CDS Synonymous[Gln75Gln]
236 .. 236 C/G rs201231738 + CDS Nonsynonymous[Thr78Ser]
311 .. 311 G/A rs145739027 + CDS Nonsynonymous[Arg103Gln]
331 .. 331 A/G rs12612365 + CDS Nonsynonymous[Ile110Val]
332 .. 332 T/C rs199581978 + CDS Nonsynonymous[Ile110Thr]
337 .. 337 G/T rs147124716 + CDS Nonsynonymous[Ala112Ser]
364 .. 364 G/C rs200279719 + CDS Nonsynonymous[Val121Leu]
393 .. 393 A/G rs201188979 + CDS Synonymous[Lys130Lys]
394 .. 394 G/T rs201124084 + CDS Nonsynonymous[Val131Leu]
411 .. 411 A/G rs186891171 + CDS Synonymous[Thr136Thr]
465 .. 465 A/G rs192501942 + CDS Synonymous[Leu154Leu]
478 .. 478 C/T rs150249098 + CDS Nonsynonymous[Arg159Cys]
553 .. 553 C/T rs138776273 + CDS Nonsynonymous[Arg184Cys]
654 .. 654 T/C rs146296595 + CDS Synonymous[Tyr217Tyr]
717 .. 717 C/T rs113179624 + CDS Synonymous[Val238Val]
725 .. 725 A/C rs117125782 + CDS Nonsynonymous[Glu241Ala]
772 .. 772 G/A rs185707555 + CDS Nonsynonymous[Val257Met]
787 .. 787 A/G rs141845828 + CDS Nonsynonymous[Met262Val]
804 .. 804 C/T rs199820298 + CDS Synonymous[Asp267Asp]
828 .. 828 C/T rs148484922 + CDS Synonymous[Pro275Pro]
841 .. 841 A/G rs150990011 + CDS Nonsynonymous[Asn280Asp]
868 .. 868 A/T rs147769180 + CDS Nonsynonymous[Ser289Cys]
882 .. 882 G/A rs141176451 + CDS Nonsynonymous[Met293Ile]
892 .. 892 C/T rs202077297 + CDS Nonsynonymous[His297Tyr]
915 .. 915 C/T rs145388354 + CDS Synonymous[Val304Val]
926 .. 926 T/C rs201839539 + CDS Nonsynonymous[Ile308Thr]
934 .. 934 G/A rs143329395 + CDS Nonsynonymous[Val311Ile]
946 .. 946 A/G rs139900748 + CDS Nonsynonymous[Ile315Val]
967 .. 967 A/C rs2160780 + CDS Nonsynonymous[Thr322Pro]
1008 .. 1008 A/G rs199581220 + CDS Synonymous[Gln335Gln]
1016 .. 1016 C/T rs201306909 + CDS Nonsynonymous[Ser338Leu]
1019 .. 1019 C/T rs200383884 + CDS Nonsynonymous[Ser339Leu]
1049 .. 1049 A/G rs113479982 + CDS Nonsynonymous[Glu349Gly]
1061 .. 1061 A/G rs138325312 + CDS Nonsynonymous[His353Arg]
1080 .. 1080 A/G rs150619658 + CDS Synonymous[Ser359Ser]
1084 .. 1084 A/G rs199650109 + CDS Nonsynonymous[Asn361Asp]
1086 .. 1086 C/T rs143507454 + CDS Synonymous[Asn361Asn]
1091 .. 1091 A/C rs151209971 + CDS Nonsynonymous[His363Pro]
1095 .. 1095 T/C rs112707279 + CDS Synonymous[Val364Val]
1132 .. 1132 G/A rs147367833 + CDS Nonsynonymous[Ala377Thr]
1138 .. 1138 A/G rs144997139 + CDS Nonsynonymous[Ile379Val]
1186 .. 1186 A/G rs190073602 + CDS Nonsynonymous[Lys395Glu]
1204 .. 1204 G/T rs192912662 + CDS Nonsynonymous[Ala401Ser]
1214 .. 1214 T/G rs141088778 + CDS Nonsynonymous[Met404Arg]
1254 .. 1254 T/C rs202045042 + CDS Synonymous[Tyr417Tyr]
1257 .. 1257 A/G rs145810685 + CDS Synonymous[Ala418Ala]
1463 .. 1463 G/A rs201723803 + CDS Nonsynonymous[Arg487His]
1480 .. 1480 C/T rs201804622 + CDS Nonsynonymous[Pro493Ser]
1486 .. 1486 C/T rs138286919 + CDS Nonsynonymous[Arg495Cys]
1509 .. 1509 T/A rs143227391 + CDS Nonsynonymous[Ser502Arg]
1535 .. 1535 C/G rs199889606 + CDS Nonsynonymous[Pro511Arg]
1536 .. 1536 A/G rs141783047 + CDS Synonymous[Pro511Pro]
1541 .. 1541 A/G rs150601215 + CDS Nonsynonymous[His513Arg]
1580 .. 1580 G/A rs201804304 + CDS Nonsynonymous[Cys526Tyr]
1583 .. 1583 A/G rs142786476 + CDS Nonsynonymous[His527Arg]
1590 .. 1590 C/A rs201676031 + CDS Nonsynonymous[Phe529Leu]
1601 .. 1601 A/C rs139534930 + CDS Nonsynonymous[Tyr533Ser]
1621 .. 1621 C/T rs143867377 + CDS Nonsynonymous[Arg540Cys]
1634 .. 1634 G/A rs142061376 + CDS Nonsynonymous[Arg544Gln]
1636 .. 1636 A/G rs112206531 + CDS Nonsynonymous[Ile545Val]
1667 .. 1667 G/C rs139768586 + CDS Nonsynonymous[Cys555Ser]
1678 .. 1678 G/A rs141290351 + CDS Nonsynonymous[Val559Ile]
1693 .. 1693 A/G rs150230256 + CDS Nonsynonymous[Met564Val]
1701 .. 1701 G/A rs148916996 + CDS Synonymous[Arg566Arg]
1702 .. 1702 A/C rs201282801 + CDS Synonymous[Arg567Arg]
1732 .. 1732 G/A rs200204477 + CDS Nonsynonymous[Ala577Thr]
1745 .. 1745 T/C rs138899346 + CDS Nonsynonymous[Val581Ala]
1757 .. 1757 C/T rs183097207 + CDS Nonsynonymous[Ser585Phe]
1837 .. 1837 A/T rs200872776 + CDS Nonsynonymous[Thr612Ser]
1839 .. 1839 T/C rs138149461 + CDS Synonymous[Thr612Thr]
1850 .. 1850 C/G rs200070040 + CDS Nonsynonymous[Thr616Arg]
1867 .. 1867 C/T rs150523011 + CDS Nonsynonymous[Pro622Ser]
1876 .. 1876 G/A rs202139397 + CDS Nonsynonymous[Ala625Thr]
1885 .. 1885 A/G rs34205800 - CDS Nonsynonymous[Ser628Gly]
1916 .. 1916 G/A rs139747916 + CDS Nonsynonymous[Arg638His]
1959 .. 1959 T/C rs146604582 + CDS Synonymous[Cys652Cys]
1994 .. 1994 G/A rs151263818 + CDS Nonsynonymous[Arg664Gln]
1999 .. 1999 C/T rs200894037 + CDS Nonsynonymous[Leu666Phe]
2013 .. 2013 G/A rs140509385 + CDS Synonymous[Gln670Gln]
2030 .. 2030 C/G rs147676010 + CDS Nonsynonymous[Ser676Trp]
2049 .. 2049 A/G rs138204529 + CDS Synonymous[Glu682Glu]
2068 .. 2068 A/G rs77437472 + CDS Nonsynonymous[Thr689Ala]
2089 .. 2089 T/G rs41285973 + CDS Nonsynonymous[Leu696Val]
2112 .. 2112 G/T rs201869646 + CDS Synonymous[Val703Val]
2185 .. 2185 A/G rs148213573 + CDS Nonsynonymous[Ile728Val]
2216 .. 2216 C/T rs146178620 + CDS Nonsynonymous[Thr738Met]
2285 .. 2285 A/G rs143058176 + CDS Nonsynonymous[Lys761Arg]
2335 .. 2335 G/A rs139995993 + CDS Nonsynonymous[Ala778Thr]
2341 .. 2341 G/C rs144800862 + CDS Nonsynonymous[Ala780Pro]
2347 .. 2347 A/G rs145489685 + CDS Nonsynonymous[Lys782Glu]
2392 .. 2392 C/A rs142316365 + CDS Nonsynonymous[Gln797Lys]
2425 .. 2425 T/C rs151000390 + CDS Nonsynonymous[Ser808Pro]
2441 .. 2441 C/A rs150135565 + CDS Nonsynonymous[Ala813Glu]
2465 .. 2465 C/A rs141861784 + CDS Nonsynonymous[Thr821Lys]
2466 .. 2466 G/C rs137938593 + CDS Synonymous[Thr821Thr]
2467 .. 2467 G/T rs199700727 + CDS Nonsynonymous[Val822Leu]
2494 .. 2494 A/G rs192756054 + CDS Nonsynonymous[Ile831Val]
2519 .. 2519 A/G rs148370960 + CDS Nonsynonymous[Lys839Arg]
2521 .. 2521 A/G rs141594305 + CDS Nonsynonymous[Lys840Glu]
2543 .. 2543 C/G rs139382504 + CDS Nonsynonymous[Thr847Ser]
2575 .. 2575 C/G rs147260381 + CDS Nonsynonymous[Pro858Ala]
2580 .. 2580 G/C rs145725176 + CDS Synonymous[Val859Val]
2601 .. 2601 A/C rs149108193 + CDS Nonsynonymous[Glu866Asp]
2682 .. 2682 G/A rs35743342 - CDS Synonymous[Glu893Glu]
2692 .. 2692 C/T rs137918800 + CDS Nonsynonymous[Leu897Phe]
2715 .. 2715 G/A rs200740029 + CDS Nonsynonymous[Met904Ile]
2849 .. 2849 A/G rs140933858 + CDS Nonsynonymous[Asn949Ser]
2864 .. 2864 A/G rs138411029 + CDS Nonsynonymous[Glu954Gly]
2880 .. 2880 T/G rs201755857 + CDS Nonsynonymous[Phe959Leu]
2910 .. 2910 A/G rs192488900 + CDS Synonymous[Gly969Gly]
2942 .. 2942 A/G rs3732235 - CDS Nonsynonymous[Asn980Ser]
3021 .. 3021 T/C rs3732233 - CDS Synonymous[Ile1006Ile]
3029 .. 3029 G/A rs201827229 + CDS Nonsynonymous[Arg1009Gln]
3031 .. 3031 T/C rs202110046 + CDS Nonsynonymous[Phe1010Leu]
3054 .. 3054 G/A rs144453296 + CDS Synonymous[Pro1017Pro]
3073 .. 3073 G/A rs200414897 + CDS Nonsynonymous[Val1024Ile]
3107 .. 3107 A/G rs79404456 + CDS Nonsynonymous[Asp1035Gly]
3135 .. 3135 C/T rs6714975 + CDS Synonymous[Asn1044Asn]
3215 .. 3215 G/A rs188031223 + CDS Nonsynonymous[Gly1071Asp]
3225 .. 3225 G/A rs201261019 + CDS Nonsynonymous[Met1074Ile]
3295 .. 3295 A/G rs200649836 + CDS Nonsynonymous[Lys1098Glu]
3307 .. 3307 T/C rs141959204 + CDS Nonsynonymous[Trp1102Arg]
3360 .. 3360 T/C rs186518279 + CDS Synonymous[Asn1119Asn]
3459 .. 3459 C/G rs139978695 + 3'UTR
3464 .. 3464 G/A rs76058335 + 3'UTR
3497 .. 3497 T/C rs147562349 + 3'UTR
3524 .. 3524 A/G rs144211981 + 3'UTR
3531 .. 3531 A/G rs201537411 + 3'UTR
3547 .. 3547 G/A rs149013084 + 3'UTR
3549 .. 3549 G/A rs199963949 + 3'UTR
3553 .. 3553 T/C rs187966415 + 3'UTR
3627 .. 3627 G/A rs148150743 + 3'UTR
3666 .. 3666 C/G rs193278190 + 3'UTR
3686 .. 3686 A/G rs141838860 + 3'UTR
3740 .. 3740 G/C rs114489501 + 3'UTR
3855 .. 3855 C/G rs142770538 + 3'UTR
3873 .. 3873 C/T rs11542286 - 3'UTR
3882 .. 3882 T/C rs201989581 + 3'UTR
3888 .. 3888 A/C rs151107068 + 3'UTR
3932 .. 3932 A/G rs143774024 + 3'UTR
4064 .. 4064 A/G rs111888663 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer