H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000087143 Accession number: BC008709 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Beta-adducin; Erythrocyte adducin subunit beta;
 
 

Motif information
ORF

length(282),orf(1:849)
VADEVQRSMGSPRPKTTWMKADEVEKSSSGMPIRIENPNQFVPLYTDPQE
VLEMRNKIREQNRQDVKSAGPQSQLLASVIAEKSRSPSTESQLMSKGDED
TKDDSEETVPNPFSQLTDQELEEYKKEVERKKLELDGEKETAPEEPGSPA
KSAPASPVQSPAKEAETKSPLVSPSKSLEEGTKKTETSKAATTEPETTQP
EGVVVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSP
EGSPSKSPSKKKKKFRTPSFLKKSKKKEKVES*
a.a.
length
InterPro Name
length(282), motif(1:282) 282 IPR027773 Beta-adducin [Family]