H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000087982 Accession number: BC012989 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Zinc finger protein ZFAT; Zinc finger gene in AITD susceptibility region; Zinc finger protein 406;
 
 

Transcript original information
Accession number BC012989.2
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:3840083
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ZFAT) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ZFAT);
Sequence data provider NA
Annotation project NA
Length of cDNA 4304[bp] (No. of exon:14)[A:1144 T:866 G:1138 C:1156]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Placenta, choriocarcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N-truncated
Kozak sequence NA
PolyA Site: 4267(+) Signal: 4246-4250(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0007808
Genomic location  G-integra Help Chromosome 8
Location 8q24.22
Position 135490032- 135708792
Strand -
Possible duplicated location(s) NA
Gene structure 14 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:57623
KEGG GENES KEGG GENES(57623)
GeneCard GeneCardZFAT*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000008138
Predicted CDS 2..3574;  1190[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.799

Motif information
ORF

length(1190),orf(2:3574)
ESEKKGCRWRGGGLTSACSVGSGGGAQHPSYSALGGGLRENTAIFMCKCC
NLFSPNQSELLSHVSEKHMEEGVNVDEIIIPLRPLSTPEPPNSSKTRDEF
LVMKRKRGRPKGSTKKSSTEEELAENIVSPTEDSPLAPEEGNSLPPSSLE
CSKCCRKFSNTRQLRKHICIIVLNLGEEEGEAGNESDLELEKKCKEDDRE
KASKRPRSQKTEKVQKISGKEARQLSGAKKPIISVVLTAHEAIPGATKIV
PVEAGPPETGATNSETTSADLVPRRGYQEYAIQQTPYEQPMKSSRLGPTQ
LKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCPQCSYASAIKANLNVH
LRKHTGEKFACDYCSFTCLSKGHLKVHIERVHKKIKQHCRFCKKKYSDVK
NLIKHIRDAHDPQDKKVKEALDELCLMTREGKRQLLYDCHICERKFKNEL
DRDRHMLVHGDKWPFACELCGHGATKYQALELHVRKHPFVYVCAVCRKKF
VSSIRLRTHIKEVHGAAQEALVFTSSINQSFCLLEPGGDIQQEALGDQLQ
LVEEEFALQGVNALKEEACPGDTQLEEGRKEPEAPGEMPAPAVHLASPQA
ESTALPPCELETTVVSSSDLHSQEVVSDDFLLKNDTSSAEAHAAPEKPPD
MQHRSSVQTQGEVITLLLSKAQSAGSDQESHGAQSPLGEGQNMAVLSAGD
PDPSRCLRSNPAEASDLLPPVAGGGDTITHQPDSCKAAPEHRSGITAFMK
VLNSLQKKQMNTSLCERIRKVYGDLECEYCGKLFWYQVHFDMHVRTHTRE
HLYYCSQCHYSSITKNCLKRHVIQKHSNILLKCPTDGCDYSTPDKYKLQA
HLKVHTALDKRSYSCPVCEKSFSEDRLIKSHIKTNHPEVSMSTISEVLGR
RVQLKGLIGKRAMKCPYCDFYFMKNGSDLQRHIWAHEGVKPFKCSLCEYA
TRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHTADGKQFK
...
a.a.
length
InterPro Name
length(24), motif(45:68) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(21), motif(149:169) 21 IPR015880 Zinc finger, C2H2-like [Domain]
length(31), motif(149:179) 31 IPR007087 Zinc finger, C2H2 [Domain]
length(31), motif(302:332) 31 IPR013087 Zinc finger C2H2-type/integrase DNA-binding domain [Domain]
length(23), motif(304:326) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(304:331) 28 IPR007087 Zinc finger, C2H2 [Domain]
length(21), motif(306:326) 21 IPR007087 Zinc finger, C2H2 [Domain]
length(23), motif(332:354) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(332:359) 28 IPR007087 Zinc finger, C2H2 [Domain]
length(26), motif(333:358) 26 IPR013087 Zinc finger C2H2-type/integrase DNA-binding domain [Domain]
length(24), motif(359:382) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(22), motif(361:382) 22 IPR007087 Zinc finger, C2H2 [Domain]
length(24), motif(387:410) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(29), motif(387:415) 29 IPR007087 Zinc finger, C2H2 [Domain]
length(22), motif(389:410) 22 IPR007087 Zinc finger, C2H2 [Domain]
length(23), motif(437:459) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(437:464) 28 IPR007087 Zinc finger, C2H2 [Domain]
length(21), motif(439:459) 21 IPR007087 Zinc finger, C2H2 [Domain]
length(23), motif(465:487) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(23), motif(465:487) 23 IPR007087 Zinc finger, C2H2 [Domain]
length(24), motif(491:514) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(29), motif(491:519) 29 IPR007087 Zinc finger, C2H2 [Domain]
length(24), motif(491:514) 24 IPR007087 Zinc finger, C2H2 [Domain]
length(22), motif(493:514) 22 IPR007087 Zinc finger, C2H2 [Domain]
length(23), motif(775:797) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(775:802) 28 IPR007087 Zinc finger, C2H2 [Domain]
length(33), motif(776:808) 33 IPR013087 Zinc finger C2H2-type/integrase DNA-binding domain [Domain]
length(21), motif(777:797) 21 IPR007087 Zinc finger, C2H2 [Domain]
length(24), motif(803:826) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(25), motif(831:855) 25 IPR015880 Zinc finger, C2H2-like [Domain]
length(40), motif(845:884) 40 IPR013087 Zinc finger C2H2-type/integrase DNA-binding domain [Domain]
length(24), motif(863:886) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(24), motif(863:886) 24 IPR007087 Zinc finger, C2H2 [Domain]
length(22), motif(865:886) 22 IPR007087 Zinc finger, C2H2 [Domain]
length(24), motif(913:936) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(29), motif(914:942) 29 IPR013087 Zinc finger C2H2-type/integrase DNA-binding domain [Domain]
length(23), motif(942:964) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(942:969) 28 IPR007087 Zinc finger, C2H2 [Domain]
length(19), motif(943:961) 19 IPR013087 Zinc finger C2H2-type/integrase DNA-binding domain [Domain]
length(33), motif(962:994) 33 IPR013087 Zinc finger C2H2-type/integrase DNA-binding domain [Domain]
length(23), motif(970:992) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(970:997) 28 IPR007087 Zinc finger, C2H2 [Domain]
length(21), motif(972:992) 21 IPR007087 Zinc finger, C2H2 [Domain]
length(36), motif(997:1032) 36 IPR013087 Zinc finger C2H2-type/integrase DNA-binding domain [Domain]
length(23), motif(999:1021) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(999:1026) 28 IPR007087 Zinc finger, C2H2 [Domain]
length(24), motif(1027:1050) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(29), motif(1027:1055) 29 IPR007087 Zinc finger, C2H2 [Domain]
length(22), motif(1029:1050) 22 IPR007087 Zinc finger, C2H2 [Domain]
length(24), motif(1074:1097) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(22), motif(1076:1097) 22 IPR007087 Zinc finger, C2H2 [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000087982
H-Inv cluster ID Locus viewHIX0007808
Accession number BC012989.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Similar to Zinc finger protein ZFAT; Zinc finger gene in AITD susceptibility region; Zinc finger protein 406;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (Q9P243)  [Identity/coverage = 99.913%/99.52%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 10819331152948721548933416421571ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ZFAT
HGNC aliases "zinc finger protein 406"
HGNC name zinc finger and AT hook domain containing
DDBJ ZFAT
UniProt ZFAT
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000008138
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:57623
KEGG GENES KEGG GENES(57623)
GeneCard GeneCardZFAT*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function metal ion binding (GO:0046872);  nucleic acid binding (GO:0003676); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
259 425 1fs7A 1e-13 7.6 147/471 a.138.1.3
409 464 1vd4A 1e-04 13.8 53/62 g.41.3.1
732 830 2g43A1 4e-09 6.7 95/117 g.44.1.5
815 976 1k2fA 5e-17 8.0 162/190 b.8.1.2
932 1104 2gb3A1 6e-04 14.2 169/100 c.67.1.1
950 987 2yrkA1 1e-05 18.4 38/48 g.37.1.4
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus NA
HG-U133 226564_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 226564_at; 
HG-U133_Plus_2 226564_at; 
HG-U95 58283_at; 
HG-U95A NA
HG-U95B 58283_at; 
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3117098;  3154701;  3154702;  3154703;  3154704;  3154721;  3154735;  3154746;  3154752;  3154755;  3154756;  3154759;  3154766;  3154768;  3154769;  3154773;  3154776;  3154784;  3154787;  3154795; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_32_P109922; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
2 .. 2 G/C rs114710253 - CDS Nonsynonymous[Glu1Gln]
176 .. 176 G/A rs201873553 - CDS Nonsynonymous[Glu59Lys]
191 .. 191 G/A rs193274691 - CDS Nonsynonymous[Val64Ile]
199 .. 199 G/A rs187529527 - CDS Synonymous[Glu66Glu]
211 .. 211 A/C rs200441089 - CDS Nonsynonymous[Glu70Asp]
290 .. 290 A/G rs17778003 - CDS Nonsynonymous[Arg97Gly]
337 .. 337 G/A rs200457313 - CDS Synonymous[Gly112Gly]
343 .. 343 G/A rs202113873 - CDS Synonymous[Thr114Thr]
385 .. 385 G/A rs200246512 - CDS Synonymous[Val128Val]
400 .. 400 C/T rs199849844 - CDS Synonymous[Asp133Asp]
404 .. 404 C/T rs12541381 - CDS Nonsynonymous[Pro135Ser]
414 .. 414 C/T rs146684203 - CDS Nonsynonymous[Pro138Leu]
483 .. 483 C/T rs143917098 - CDS Nonsynonymous[Thr161Met]
484 .. 484 G/A rs138394119 - CDS Synonymous[Thr161Thr]
514 .. 514 C/T rs200807830 - CDS Synonymous[Ile171Ile]
542 .. 542 G/C rs202134657 - CDS Nonsynonymous[Glu181Gln]
596 .. 596 C/T rs75596750 - CDS Nonsynonymous[Arg199Trp]
615 .. 615 G/C rs201828593 - CDS Nonsynonymous[Arg205Thr]
617 .. 617 C/G rs199920798 - CDS Nonsynonymous[Pro206Ala]
620 .. 620 C/T rs200967006 - CDS Nonsynonymous[Arg207Trp]
677 .. 677 T/C rs201681098 - CDS Nonsynonymous[Ser226Pro]
684 .. 684 C/T rs192292042 - CDS Nonsynonymous[Ala228Val]
822 .. 822 G/C rs199802452 - CDS Nonsynonymous[Arg274Pro]
979 .. 979 C/T rs143741585 - CDS Synonymous[His326His]
1009 .. 1009 G/A rs187092112 - CDS Synonymous[Gln336Gln]
1079 .. 1079 G/C rs79889362 - CDS Nonsynonymous[Ala360Pro]
1085 .. 1085 G/A rs182039992 - CDS Nonsynonymous[Asp362Asn]
1089 .. 1089 A/G rs200174150 - CDS Nonsynonymous[Tyr363Cys]
1090 .. 1090 T/C rs3739422 + CDS Synonymous[Tyr363Tyr]
1154 .. 1154 A/G rs75824083 - CDS Nonsynonymous[Ile385Val]
1169 .. 1169 C/T rs143158019 - CDS Nonsynonymous[Arg390Cys]
1227 .. 1227 C/T rs199724546 - CDS Nonsynonymous[Ala409Val]
1278 .. 1278 T/A rs201752594 - CDS Nonsynonymous[Leu426Gln]
1309 .. 1309 C/G rs202211030 - CDS Synonymous[Leu436Leu]
1315 .. 1315 C/G rs201292104 - CDS Nonsynonymous[Asp438Glu]
1342 ^ 1343 -/T rs34615535 - CDS
1345 .. 1345 C/T rs200140182 - CDS Synonymous[Asn448Asn]
1357 .. 1357 C/T rs3739423 + CDS Synonymous[Arg452Arg]
1363 ^ 1364 -/CCCCCC rs141961813 - CDS
1378 .. 1378 C/T rs201121080 - CDS Synonymous[His459His]
1468 .. 1468 C/T rs199567565 - CDS Synonymous[Phe489Phe]
1474 .. 1474 C/T rs201972924 - CDS Synonymous[Tyr491Tyr]
1477 .. 1477 C/A rs200259422 - CDS Synonymous[Val492Val]
1483 .. 1483 C/T rs115542684 - CDS Synonymous[Ala494Ala]
1491 .. 1491 G/A rs189623686 - CDS Nonsynonymous[Arg497His]
1501 .. 1501 C/T rs199619199 - CDS Synonymous[Phe500Phe]
1509 .. 1509 C/G rs112892337 - CDS Nonsynonymous[Ser503Cys]
1532 .. 1532 A/G rs200147714 - CDS Nonsynonymous[Lys511Glu]
1634 .. 1634 C/T rs34008545 - CDS Synonymous[Leu545Leu]
1645 .. 1645 G/C rs201617045 - CDS Nonsynonymous[Gln548His]
1736 .. 1736 C/T rs142331855 - CDS Nonsynonymous[Arg579Trp]
1745 .. 1745 C/T rs180691057 - CDS Nonsynonymous[Pro582Ser]
1746 .. 1746 C/T rs202155119 - CDS Nonsynonymous[Pro582Leu]
1752 .. 1752 C/A rs199682848 - CDS Nonsynonymous[Ala584Asp]
1832 .. 1832 G/A rs200262210 - CDS Nonsynonymous[Glu611Lys]
1841 .. 1841 G/A rs79599902 - CDS Nonsynonymous[Val614Met]
1916 .. 1916 G/A rs201380546 - CDS Nonsynonymous[Ala639Thr]
2016 .. 2016 A/G rs200703177 - CDS Nonsynonymous[Gln672Arg]
2047 .. 2047 C/T rs145169577 - CDS Synonymous[Gly682Gly]
2115 .. 2115 G/A rs35003767 - CDS Nonsynonymous[Arg705Lys]
2118 .. 2118 G/A rs202196720 - CDS Nonsynonymous[Cys706Tyr]
2135 .. 2135 G/A rs188333537 - CDS Nonsynonymous[Ala712Thr]
2225 .. 2225 C/G rs200943503 - CDS Nonsynonymous[Arg742Gly]
2226 .. 2226 G/A rs201041569 - CDS Nonsynonymous[Arg742Gln]
2388 .. 2388 C/A rs78880232 - CDS Nonsynonymous[Thr796Asn]
2464 .. 2464 C/T rs200425686 - CDS Synonymous[His821His]
2506 .. 2506 C/T rs144002982 - CDS Synonymous[Thr835Thr]
2509 .. 2509 T/C rs894344 - CDS Synonymous[Asp836Asp]
2510 .. 2510 G/A rs201031325 - CDS Nonsynonymous[Gly837Ser]
2583 .. 2583 G/A rs138033806 - CDS Nonsynonymous[Arg861Lys]
2584 .. 2584 G/A rs3739424 + CDS Synonymous[Arg861Arg]
2593 .. 2593 T/C rs3739425 + CDS Synonymous[Ser864Ser]
2632 .. 2632 G/A rs10505626 - CDS Synonymous[Leu877Leu]
2644 .. 2644 T/C rs202167634 - CDS Synonymous[His881His]
2862 .. 2862 A/G rs193040099 - CDS Nonsynonymous[Lys954Arg]
2905 .. 2905 A/G rs144631711 - CDS Synonymous[Lys968Lys]
2912 ^ 2913 -/C rs35426796 - CDS
2919 .. 2919 A/G rs199996485 - CDS Nonsynonymous[Asp973Gly]
3024 .. 3024 C/T rs200726532 - CDS Nonsynonymous[Ala1008Val]
3196 .. 3196 G/A rs199671548 - CDS Synonymous[Ala1065Ala]
3247 .. 3247 A/G rs114589731 - CDS Synonymous[Val1082Val]
3341 .. 3341 G/A rs187568306 - CDS Nonsynonymous[Glu1114Lys]
3346 .. 3346 G/A rs200051218 - CDS Synonymous[Glu1115Glu]
3366 .. 3366 C/G rs181970358 - CDS Nonsynonymous[Thr1122Arg]
3397 .. 3397 G/A rs188324571 - CDS Synonymous[Ala1132Ala]
3425 .. 3425 C/T rs140801453 - CDS Synonymous[Leu1142Leu]
3463 .. 3463 G/A rs61748832 - CDS Synonymous[Thr1154Thr]
3485 .. 3485 G/A rs200658838 - CDS Nonsynonymous[Gly1162Arg]
3525 .. 3525 T/C rs201818197 - CDS Nonsynonymous[Met1175Thr]
3559 .. 3559 G/A rs143856467 - CDS Synonymous[Pro1186Pro]
3567 .. 3567 A/G rs199857189 - CDS Nonsynonymous[Glu1189Gly]
3619 .. 3619 C/T rs148077944 - 3'UTR
3688 .. 3688 C/T rs143609415 - 3'UTR
3760 .. 3760 C/T rs11538239 - 3'UTR
3782 .. 3782 C/G rs185127495 - 3'UTR
3871 .. 3871 T/C rs149312401 - 3'UTR
3907 .. 3907 C/G rs138616859 - 3'UTR
3958 .. 3958 C/T rs116877116 - 3'UTR
4117 .. 4117 C/T rs144769555 - 3'UTR
4143 .. 4143 C/T rs180881285 - 3'UTR
4166 .. 4166 C/T rs188846777 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer