H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000087982 Accession number: BC012989 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Zinc finger protein ZFAT; Zinc finger gene in AITD susceptibility region; Zinc finger protein 406;
 
 

Motif information
ORF

length(1190),orf(2:3574)
ESEKKGCRWRGGGLTSACSVGSGGGAQHPSYSALGGGLRENTAIFMCKCC
NLFSPNQSELLSHVSEKHMEEGVNVDEIIIPLRPLSTPEPPNSSKTRDEF
LVMKRKRGRPKGSTKKSSTEEELAENIVSPTEDSPLAPEEGNSLPPSSLE
CSKCCRKFSNTRQLRKHICIIVLNLGEEEGEAGNESDLELEKKCKEDDRE
KASKRPRSQKTEKVQKISGKEARQLSGAKKPIISVVLTAHEAIPGATKIV
PVEAGPPETGATNSETTSADLVPRRGYQEYAIQQTPYEQPMKSSRLGPTQ
LKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCPQCSYASAIKANLNVH
LRKHTGEKFACDYCSFTCLSKGHLKVHIERVHKKIKQHCRFCKKKYSDVK
NLIKHIRDAHDPQDKKVKEALDELCLMTREGKRQLLYDCHICERKFKNEL
DRDRHMLVHGDKWPFACELCGHGATKYQALELHVRKHPFVYVCAVCRKKF
VSSIRLRTHIKEVHGAAQEALVFTSSINQSFCLLEPGGDIQQEALGDQLQ
LVEEEFALQGVNALKEEACPGDTQLEEGRKEPEAPGEMPAPAVHLASPQA
ESTALPPCELETTVVSSSDLHSQEVVSDDFLLKNDTSSAEAHAAPEKPPD
MQHRSSVQTQGEVITLLLSKAQSAGSDQESHGAQSPLGEGQNMAVLSAGD
PDPSRCLRSNPAEASDLLPPVAGGGDTITHQPDSCKAAPEHRSGITAFMK
VLNSLQKKQMNTSLCERIRKVYGDLECEYCGKLFWYQVHFDMHVRTHTRE
HLYYCSQCHYSSITKNCLKRHVIQKHSNILLKCPTDGCDYSTPDKYKLQA
HLKVHTALDKRSYSCPVCEKSFSEDRLIKSHIKTNHPEVSMSTISEVLGR
RVQLKGLIGKRAMKCPYCDFYFMKNGSDLQRHIWAHEGVKPFKCSLCEYA
TRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHTADGKQFK
...
a.a.
length
InterPro Name
length(24), motif(45:68) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(21), motif(149:169) 21 IPR015880 Zinc finger, C2H2-like [Domain]
length(31), motif(149:179) 31 IPR007087 Zinc finger, C2H2 [Domain]
length(31), motif(302:332) 31 IPR013087 Zinc finger C2H2-type/integrase DNA-binding domain [Domain]
length(23), motif(304:326) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(304:331) 28 IPR007087 Zinc finger, C2H2 [Domain]
length(21), motif(306:326) 21 IPR007087 Zinc finger, C2H2 [Domain]
length(23), motif(332:354) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(332:359) 28 IPR007087 Zinc finger, C2H2 [Domain]
length(26), motif(333:358) 26 IPR013087 Zinc finger C2H2-type/integrase DNA-binding domain [Domain]
length(24), motif(359:382) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(22), motif(361:382) 22 IPR007087 Zinc finger, C2H2 [Domain]
length(24), motif(387:410) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(29), motif(387:415) 29 IPR007087 Zinc finger, C2H2 [Domain]
length(22), motif(389:410) 22 IPR007087 Zinc finger, C2H2 [Domain]
length(23), motif(437:459) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(437:464) 28 IPR007087 Zinc finger, C2H2 [Domain]
length(21), motif(439:459) 21 IPR007087 Zinc finger, C2H2 [Domain]
length(23), motif(465:487) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(23), motif(465:487) 23 IPR007087 Zinc finger, C2H2 [Domain]
length(24), motif(491:514) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(29), motif(491:519) 29 IPR007087 Zinc finger, C2H2 [Domain]
length(24), motif(491:514) 24 IPR007087 Zinc finger, C2H2 [Domain]
length(22), motif(493:514) 22 IPR007087 Zinc finger, C2H2 [Domain]
length(23), motif(775:797) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(775:802) 28 IPR007087 Zinc finger, C2H2 [Domain]
length(33), motif(776:808) 33 IPR013087 Zinc finger C2H2-type/integrase DNA-binding domain [Domain]
length(21), motif(777:797) 21 IPR007087 Zinc finger, C2H2 [Domain]
length(24), motif(803:826) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(25), motif(831:855) 25 IPR015880 Zinc finger, C2H2-like [Domain]
length(40), motif(845:884) 40 IPR013087 Zinc finger C2H2-type/integrase DNA-binding domain [Domain]
length(24), motif(863:886) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(24), motif(863:886) 24 IPR007087 Zinc finger, C2H2 [Domain]
length(22), motif(865:886) 22 IPR007087 Zinc finger, C2H2 [Domain]
length(24), motif(913:936) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(29), motif(914:942) 29 IPR013087 Zinc finger C2H2-type/integrase DNA-binding domain [Domain]
length(23), motif(942:964) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(942:969) 28 IPR007087 Zinc finger, C2H2 [Domain]
length(19), motif(943:961) 19 IPR013087 Zinc finger C2H2-type/integrase DNA-binding domain [Domain]
length(33), motif(962:994) 33 IPR013087 Zinc finger C2H2-type/integrase DNA-binding domain [Domain]
length(23), motif(970:992) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(970:997) 28 IPR007087 Zinc finger, C2H2 [Domain]
length(21), motif(972:992) 21 IPR007087 Zinc finger, C2H2 [Domain]
length(36), motif(997:1032) 36 IPR013087 Zinc finger C2H2-type/integrase DNA-binding domain [Domain]
length(23), motif(999:1021) 23 IPR015880 Zinc finger, C2H2-like [Domain]
length(28), motif(999:1026) 28 IPR007087 Zinc finger, C2H2 [Domain]
length(24), motif(1027:1050) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(29), motif(1027:1055) 29 IPR007087 Zinc finger, C2H2 [Domain]
length(22), motif(1029:1050) 22 IPR007087 Zinc finger, C2H2 [Domain]
length(24), motif(1074:1097) 24 IPR015880 Zinc finger, C2H2-like [Domain]
length(22), motif(1076:1097) 22 IPR007087 Zinc finger, C2H2 [Domain]