H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000088289 Accession number: BC014125 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Splicing factor 3B subunit 2; Pre-mRNA-splicing factor SF3b 145 kDa subunit; SF3b145; SF3b150; Spliceosome-associated protein 145; SAP 145;
 
 

Transcript original information
Accession number BC014125.2
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:4562562
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider NA
Annotation project NA
Length of cDNA 1284[bp] (No. of exon:10)[A:380 T:249 G:358 C:297]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Kidney, renal cell adenocarcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1261(+) Signal: 1241-1245(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGAAG; 
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0009823
Genomic location  G-integra Help Chromosome 11
Location 11q13.1
Position 65827424- 65836361
Strand +
Possible duplicated location(s) NA
Gene structure 10 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:10992
KEGG GENES KEGG GENES(10992)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000221660
Predicted CDS 34..1116;  360[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.815

Motif information
ORF

length(360),orf(34:1116)
MREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLT
IHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIA
MQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGD
VFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDET
GFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFT
VLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELEL
DPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRG
GSKKYKEFKF*
a.a.
length
InterPro Name
length(62), motif(1:62) 62 IPR007180 Domain of unknown function DUF382 [Domain]
length(59), motif(66:124) 59 IPR006568 PSP, proline-rich [Domain]
length(53), motif(70:122) 53 IPR006568 PSP, proline-rich [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000088289
H-Inv cluster ID Locus viewHIX0009823
Accession number BC014125.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Splicing factor 3B subunit 2; Pre-mRNA-splicing factor SF3b 145 kDa subunit; SF3b145; SF3b150; Spliceosome-associated protein 145; SAP 145;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (Q13435)  [Identity/coverage = 100.0%/41.45%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 8566756108821141199163812234937127388651470203915146077154893341692395917081983175253321831800818669648186919761960886119690332200682312126946021406692ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ SF3B2
UniProt SF3B2
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000221660
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:10992
KEGG GENES KEGG GENES(10992)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Cellular component nucleus (GO:0005634); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
7 109 1n9wA2 2e-09 17.5 97/100 d.104.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA180309; 
Affymetrix
GeneChip
HG-Focus 200619_at; 
HG-U133 200619_at; 
HG-U133A 200619_at; 
HG-U133A_2 200619_at; 
HG-U133B NA
HG-U133_Plus_2 200619_at; 
HG-U95 36973_at; 
HG-U95A 36973_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3335935;  3335936;  3335939;  3335940;  3335941;  3335942;  3335943;  3335944;  3335946;  3335947;  3335949;  3335950; 
HuGeneFL U41371_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P64082; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P64083; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
10 .. 10 A/G rs200555928 + 5'UTR
16 .. 16 C/T rs199609387 + 5'UTR
253 .. 253 C/T rs201553683 + CDS Synonymous[Leu74Leu]
263 .. 263 A/C rs200516150 + CDS Nonsynonymous[Glu77Ala]
277 .. 277 T/C rs79598943 + CDS Synonymous[Leu82Leu]
289 .. 289 G/A rs199997051 + CDS Nonsynonymous[Val86Ile]
354 .. 354 C/G rs200985249 + CDS Synonymous[Pro107Pro]
393 .. 393 G/A rs72932689 + CDS Synonymous[Ser120Ser]
468 .. 468 A/G rs113220857 + CDS Synonymous[Lys145Lys]
483 .. 483 C/T rs200458765 + CDS Synonymous[Asp150Asp]
547 .. 547 C/T rs199621782 + CDS Nonsynonymous[Pro172Ser]
576 .. 576 A/G rs202184570 + CDS Synonymous[Glu181Glu]
597 .. 597 A/G rs201734524 + CDS Synonymous[Glu188Glu]
611 .. 611 A/G rs11554201 + CDS Nonsynonymous[Asp193Gly]
756 .. 756 C/T rs139622723 + CDS Synonymous[Asp241Asp]
797 .. 797 A/G rs143453448 + CDS Nonsynonymous[Lys255Arg]
831 .. 831 A/G rs199782165 + CDS Synonymous[Gly266Gly]
858 .. 858 G/A rs201160612 + CDS Synonymous[Thr275Thr]
876 .. 876 C/T rs146187153 + CDS Synonymous[Gly281Gly]
915 .. 915 G/A/C rs112398687 + CDS
918 .. 918 T/A rs200682390 + CDS Synonymous[Pro295Pro]
972 .. 972 G/A rs144057362 + CDS Synonymous[Val313Val]
987 .. 987 T/C rs144944219 + CDS Synonymous[Ala318Ala]
999 .. 999 G/C rs11554198 + CDS Nonsynonymous[Lys322Asn]
1079 .. 1079 G/A rs148991018 + CDS Nonsynonymous[Arg349His]
1092 .. 1092 G/A rs1049973 + CDS Synonymous[Lys353Lys]
1134 .. 1134 C/T rs200551157 + 3'UTR
1188 .. 1188 C/T rs117837147 + 3'UTR
1223 .. 1223 T/A rs3210005 + 3'UTR
1253 .. 1253 T/C rs190567887 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer