H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000088289 Accession number: BC014125 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Splicing factor 3B subunit 2; Pre-mRNA-splicing factor SF3b 145 kDa subunit; SF3b145; SF3b150; Spliceosome-associated protein 145; SAP 145;
 
 

Motif information
ORF

length(360),orf(34:1116)
MREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLT
IHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIA
MQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGD
VFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDET
GFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFT
VLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELEL
DPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRG
GSKKYKEFKF*
a.a.
length
InterPro Name
length(62), motif(1:62) 62 IPR007180 Domain of unknown function DUF382 [Domain]
length(59), motif(66:124) 59 IPR006568 PSP, proline-rich [Domain]
length(53), motif(70:122) 53 IPR006568 PSP, proline-rich [Domain]