H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000088467 Accession number: BC014669 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Superkiller viralicidic activity 2-like 2.
 
 

Motif information
ORF

length(706),orf(3:2123)
DFREDKFNTAMQVLRDAGDLAKGDQKGRKGGTKGPSNVFKIVKMIMERNF
QPVIIFSFSKKDCEAYALQMTKLDFNTDEEKKMVEEVFSNAIDCLSDEDK
KLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLIKALFATETFA
MGINMPARTVLFTNARKFDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVI
LMVDEKMSPTIGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLE
KSFYQFQHYRAIPGVVEKVKNSEEQYNKIVIPNEESVVIYYKIRQQLAKL
GKEIEEYIHKPKYCLPFLQPGRLVKVKNEGDDFGWGVVVNFSKKSNVKPN
SGELDPLYVVEVLLRCSKESLKNSATEAAKPAKPDEKGEMQVVPVLVHLL
SAISSVRLYIPKDLRPVDNRQSVLKSIQEVQKRFPDGIPLLDPIDDMGIQ
DQGLKKVIQKVEAFEHRMYSHPLHNDPNLETVYTLCEKKAQIAIDIKSAK
RELKKARTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACEISSADEL
LLTEMMFNGLFNDLSAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQ
ECAKRIAKVSAEAKLEIDEETYLSSFKPHLMDVVYTWATGATFAHICKMT
DVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKFAEGITKIKRDIVF
AASLYL*
a.a.
length
InterPro Name
length(41), motif(36:76) 41 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(173), motif(37:209) 173 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(173), motif(69:241) 173 IPR001650 Helicase, C-terminal [Domain]
length(90), motif(103:192) 90 IPR001650 Helicase, C-terminal [Domain]
length(90), motif(116:205) 90 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(76), motif(117:192) 76 IPR001650 Helicase, C-terminal [Domain]
length(261), motif(246:506) 261 IPR025696 rRNA-processing arch domain [Domain]
length(177), motif(530:706) 177 IPR012961 DSH, C-terminal [Domain]