H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000088788 Accession number: BC015709 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to X-box-binding protein 1; XBP-1; Tax-responsive element-binding protein 5;
 
 

Transcript original information
Accession number BC015709.1
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:3911945
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (XBP1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (XBP1);
Sequence data provider NA
Annotation project NA
Length of cDNA 1730[bp] (No. of exon:5)[A:463 T:440 G:411 C:416]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Uterus, leiomyosarcoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N-truncated
Kozak sequence NA
PolyA Site: 1713(+) Signal: 1696-1700(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0016344
Genomic location  G-integra Help Chromosome 22
Location 22q12.1
Position 29190548- 29196453
Strand -
Possible duplicated location(s) NA
Gene structure 5 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:7494
KEGG GENES KEGG GENES(7494)
GeneCard GeneCardXBP1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000126930
Predicted CDS 2..727;  241[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.733

Motif information
ORF

length(241),orf(2:727)
SGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPE
EKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLR
EKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLR
APLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNAL
PQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN*
a.a.
length
InterPro Name
length(65), motif(48:112) 65 IPR004827 Basic-leucine zipper domain [Domain]
length(52), motif(49:100) 52 IPR004827 Basic-leucine zipper domain [Domain]
length(64), motif(50:113) 64 IPR004827 Basic-leucine zipper domain [Domain]
length(16), motif(55:70) 16 IPR004827 Basic-leucine zipper domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000088788
H-Inv cluster ID Locus viewHIX0016344
Accession number BC015709.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to X-box-binding protein 1; XBP-1; Tax-responsive element-binding protein 5;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (P17861)  [Identity/coverage = 100.0%/92.34%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 219617623210188349596865756610591208117794641294953415461802154893341695997417224074ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol XBP1
HGNC aliases NA
HGNC name X-box binding protein 1
DDBJ NA
UniProt XBP1
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000126930
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:7494
KEGG GENES KEGG GENES(7494)
GeneCard GeneCardXBP1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function sequence-specific DNA binding (GO:0043565);  transcription factor activity (GO:0003700); 
Biological process regulation of transcription, DNA-dependent (GO:0006355); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear; 
Target P Not predicted
SOSUI membrane protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA121414;  AGhsC100421; 
Affymetrix
GeneChip
HG-Focus 200670_at; 
HG-U133 200670_at; 
HG-U133A 200670_at; 
HG-U133A_2 200670_at; 
HG-U133B NA
HG-U133_Plus_2 200670_at; 
HG-U95 39755_at;  39756_g_at;  71584_at; 
HG-U95A 39755_at;  39756_g_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E 71584_at; 
HG-U95Av2 NA
HuEx-1_0 2824309;  2824310;  2871188;  3941660;  3941662;  3941664;  3941666;  3941668;  3956591;  3956592;  3956593;  3956594;  3956597;  3956598;  3956600;  3956604;  3956607; 
HuGeneFL M31627_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P120845; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P120845;  A_24_P100228; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:27-May-2015
Disease relation Disease name: {Major affective disorder-7, susceptibility to} (612371); 
Related information in OMIM OMIM ID:  194355;  Title: X BOX-BINDING PROTEIN 1
Co-localized orphan diseases NA
Disease related mutation MutationView:  194355
JRE-1.4.0 or later is required.Download JRE at Sun's web site.
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(7494)
Disease Entrez Gene ID:(7494)
Substance Entrez Gene ID:(7494)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
148 .. 148 C/T rs2228260 + CDS Synonymous[Pro49Pro]
266 .. 266 A/G rs201787803 - CDS Nonsynonymous[Asn89Asp]
283 .. 283 A/G rs200066767 - CDS Synonymous[Leu94Leu]
353 .. 353 G/A rs146780960 - CDS Nonsynonymous[Gly118Arg]
358 .. 358 G/A rs143559198 - CDS Nonsynonymous[Met119Ile]
380 .. 380 G/T rs11554255 + CDS AA-STOP[Glu127*]
381 .. 381 A/C rs148722004 - CDS Nonsynonymous[Glu127Ala]
385 .. 385 G/A rs144266565 - CDS Synonymous[Ala128Ala]
425 .. 425 G/C rs149590204 - CDS Nonsynonymous[Ala142Pro]
508 .. 508 G/T rs202092544 - CDS Nonsynonymous[Trp169Cys]
516 .. 516 C/T rs139355676 - CDS Nonsynonymous[Ala172Val]
517 .. 517 G/A rs147520314 - CDS Synonymous[Ala172Ala]
552 .. 552 G/A rs143298350 - CDS Nonsynonymous[Cys184Tyr]
593 .. 593 A/T/G rs112130171 - CDS
612 .. 612 T/C rs146909963 - CDS Nonsynonymous[Leu204Pro]
661 .. 661 T/C rs199555020 - CDS Synonymous[Pro220Pro]
671 .. 671 C/A rs141132139 - CDS Nonsynonymous[Pro224Thr]
685 .. 685 G/T rs200606332 - CDS Nonsynonymous[Gln228His]
897 .. 897 C/T rs188610986 - 3'UTR
925 .. 925 C/T rs1803772 + 3'UTR
1003 .. 1003 T/C rs1064181 + 3'UTR
1182 .. 1182 A/G rs77215973 - 3'UTR
1188 .. 1188 C/T rs114310500 - 3'UTR
1254 .. 1254 G/- rs35907467 - 3'UTR
1297 .. 1297 T/C rs142331338 - 3'UTR
1309 .. 1309 A/G rs185730908 - 3'UTR
1342 .. 1342 T/C rs80010340 - 3'UTR
1466 .. 1466 C/T rs113558206 - 3'UTR
1594 .. 1594 T/G rs137946912 - 3'UTR
1615 .. 1615 T/A rs150321792 - 3'UTR
1618 .. 1618 A/G rs14963 + 3'UTR
1624 .. 1624 T/C rs34731735 + 3'UTR
1673 .. 1673 A/G rs148234234 - 3'UTR
1709 .. 1709 A/G rs56058284 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer