H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000089280 Accession number: BC017414 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Signal recognition particle 9 kDa protein isoform 2.
 
 

Transcript original information
Accession number BC017414.1
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:4655251
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (SRP9) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (SRP9);
Sequence data provider NA
Annotation project NA
Length of cDNA 1269[bp] (No. of exon:1)[A:432 T:437 G:231 C:169]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Lung, mucoepidermoid carcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N-truncated
Kozak sequence NA
PolyA Site: 1240(+) Signal: 1225-1229(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001635
Genomic location  G-integra Help Chromosome 1
Location 1q42.12
Position 225976942- 225978161
Strand +
Possible duplicated location(s) NA
Gene structure 1 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:6726
KEGG GENES KEGG GENES(6726)
GeneCard GeneCardSRP9*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000132929
Predicted CDS 3..140;  45[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.649

Motif information
ORF

length(45),orf(3:140)
VTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE*
a.a.
length
InterPro Name
length(39), motif(1:39) 39 IPR009018 Signal recognition particle, SRP9/SRP14 subunit [Domain]
length(45), motif(1:45) 45 IPR009018 Signal recognition particle, SRP9/SRP14 subunit [Domain]
length(45), motif(1:45) 45 IPR008832 Signal recognition particle, SRP9 subunit [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000089280
H-Inv cluster ID Locus viewHIX0001635
Accession number BC017414.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Signal recognition particle 9 kDa protein isoform 2.
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (NP_003124)  [Identity/coverage = 100.0%/52.33%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol SRP9
HGNC aliases "signal recognition particle 9kD"
HGNC name signal recognition particle 9kDa
DDBJ NA
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000132929
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:6726
KEGG GENES KEGG GENES(6726)
GeneCard GeneCardSRP9*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function 7S RNA binding (GO:0008312); 
Biological process negative regulation of translational elongation (GO:0045900);  SRP-dependent cotranslational protein targeting to membrane (GO:0006614); 
Cellular component signal recognition particle (GO:0048500); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear;  extracellular; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA011014; 
Affymetrix
GeneChip
HG-Focus 201273_s_at; 
HG-U133 201273_s_at; 
HG-U133A 201273_s_at; 
HG-U133A_2 201273_s_at; 
HG-U133B NA
HG-U133_Plus_2 201273_s_at; 
HG-U95 36981_at; 
HG-U95A 36981_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2382886;  2382887;  2382888;  2382889;  2458503;  3257926;  3257927;  3300190;  3300191; 
HuGeneFL U20998_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P45928; 
Whole Human Genome Oligo Microarray:PGID247 A_32_P151594;  A_32_P165340; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
114 .. 114 C/T rs199511703 + CDS Nonsynonymous[Arg38Cys]
118 .. 118 A/G rs201568819 + CDS Nonsynonymous[Asn39Ser]
128 .. 128 G/A rs149323412 + CDS Nonsynonymous[Met42Ile]
164 .. 164 C/T rs200262058 + 3'UTR
167 .. 167 G/A rs146544886 + 3'UTR
297 .. 297 C/G rs188550487 + 3'UTR
313 .. 313 T/C rs141268331 + 3'UTR
352 .. 352 C/G rs74604368 - 3'UTR
467 .. 467 A/C rs11555109 - 3'UTR
587 .. 587 T/C rs189915800 + 3'UTR
612 .. 612 G/A rs182555497 + 3'UTR
617 .. 617 C/T rs11555121 + 3'UTR
821 .. 821 T/C rs11555113 - 3'UTR
831 .. 831 G/A rs145846119 + 3'UTR
961 .. 961 C/T rs186531623 + 3'UTR
1024 .. 1024 T/C rs191367978 + 3'UTR
1047 .. 1047 C/T rs1050033 + 3'UTR
1049 .. 1049 A/G rs184461856 + 3'UTR
1086 .. 1086 G/C rs14113 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer