H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000089646 Accession number: BC018620 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Poly [ADP-ribose] polymerase 1; PARP-1; EC=2.4.2.30; ADP-ribosyltransferase diphtheria toxin-like 1; ARTD1; NAD(+) ADP-ribosyltransferase 1; ADPRT 1; Poly[ADP-ribose] synthase 1;
 
 

Motif information
ORF

length(232),orf(132:827)
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPH
WYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD
GIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQ
LGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLP
GVKSEGKRKGDEVDGVDEVAKKKSKKKKKKKK
a.a.
length
InterPro Name
length(100), motif(2:101) 100 IPR001510 Zinc finger, PARP-type [Domain]
length(85), motif(9:93) 85 IPR001510 Zinc finger, PARP-type [Domain]
length(78), motif(12:89) 78 IPR001510 Zinc finger, PARP-type [Domain]
length(36), motif(21:56) 36 IPR001510 Zinc finger, PARP-type [Domain]
length(107), motif(108:214) 107 IPR001510 Zinc finger, PARP-type [Domain]
length(91), motif(113:203) 91 IPR001510 Zinc finger, PARP-type [Domain]
length(84), motif(116:199) 84 IPR001510 Zinc finger, PARP-type [Domain]
length(38), motif(125:162) 38 IPR001510 Zinc finger, PARP-type [Domain]