H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000090056 Accession number: BC020268 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: DNA replication licensing factor MCM6; EC=3.6.4.12; p105MCM;
 
 

Motif information
ORF

length(821),orf(41:2506)
MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLA
EELIRPERNTLVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKD
RKEIPLAKDFYVAFQDLPTRHKIRELTSSRIGLLTRISGQVVRTHPVHPE
LVSGTFLCLDCQTVIRDVEQQFKYTQPNICRNPVCANRRRFLLDTNKSRF
VDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGDKCDFTGTLIV
VPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLA
CCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNL
CTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPST
AKSQFLKHVEEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALM
LADNGVCCIDEFDKMDVRDQVAIHEAMEQQTISITKAGVKATLNARTSIL
AAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIAR
RIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKH
LRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFR
LLNKSIIRVETPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYN
EDINQESAPKASLRLGFSEYCRISNLIVLHLRKVEEEEDESALKRSELVN
WYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTE
GSESYEEDPYLVVNPNYLLED*
a.a.
length
InterPro Name
length(114), motif(26:139) 114 IPR027925 MCM N-terminal domain [Domain]
length(225), motif(29:253) 225 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(13), motif(83:95) 13 IPR008049 DNA replication licensing factor Mcm6 [Family]
length(539), motif(119:657) 539 IPR001208 Mini-chromosome maintenance, DNA-dependent ATPase [Family]
length(13), motif(120:132) 13 IPR008049 DNA replication licensing factor Mcm6 [Family]
length(28), motif(122:149) 28 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(51), motif(151:201) 51 IPR004039 Rubredoxin-type fold [Domain]
length(18), motif(170:187) 18 IPR008049 DNA replication licensing factor Mcm6 [Family]
length(52), motif(202:253) 52 IPR012340 Nucleic acid-binding, OB-fold [Domain]
length(12), motif(223:234) 12 IPR008049 DNA replication licensing factor Mcm6 [Family]
length(22), motif(280:301) 22 IPR008049 DNA replication licensing factor Mcm6 [Family]
length(323), motif(334:656) 323 IPR001208 Mini-chromosome maintenance, DNA-dependent ATPase [Family]
length(207), motif(346:552) 207 IPR001208 Mini-chromosome maintenance, DNA-dependent ATPase [Family]
length(182), motif(354:535) 182 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(317), motif(355:671) 317 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(16), motif(387:402) 16 IPR001208 Mini-chromosome maintenance, DNA-dependent ATPase [Family]
length(15), motif(447:461) 15 IPR001208 Mini-chromosome maintenance, DNA-dependent ATPase [Family]
length(9), motif(455:463) 9 IPR018525 Mini-chromosome maintenance, conserved site [Conserved_site]
length(14), motif(475:488) 14 IPR001208 Mini-chromosome maintenance, DNA-dependent ATPase [Family]
length(13), motif(499:511) 13 IPR001208 Mini-chromosome maintenance, DNA-dependent ATPase [Family]
length(9), motif(526:534) 9 IPR001208 Mini-chromosome maintenance, DNA-dependent ATPase [Family]