H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000091166 Accession number: BC026042 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Uncharacterized protein C21orf58;
 
 

Transcript original information
Accession number BC026042.1
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:4587655
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (C21orf58) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (C21orf58);
Sequence data provider NA
Annotation project NA
Length of cDNA 2960[bp] (No. of exon:9)[A:640 T:556 G:844 C:920]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Kidney, renal cell adenocarcinoma
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N-truncated
Kozak sequence NA
PolyA Site: 2941(+) Signal: 2922-2926(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0203120
Genomic location  G-integra Help Chromosome 21
Location 21q22.3
Position 47721047- 47743789
Strand -
Possible duplicated location(s) NA
Gene structure 9 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:54058
KEGG GENES KEGG GENES(54058)
GeneCard GeneCardC21orf58*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000336897
Predicted CDS 1684..2355;  223[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.797

Motif information
ORF

length(223),orf(1684:2355)
PWKGLPVMAILPGEAPVPGPGWPEPDAGGASVALGLPVPVCSSSASALQE
QHLLDELSRAQAWSGPSRGALGSALPPELPPTGILPTASPSPLAPDPPRI
ILPTVPQPPATIIQQLPQQPLIAQIPPPQAFPTQRSGSIKEDMVELLLLQ
NAQVHQLVLQNWMLKALPPALQDPPHVPPRVPRAARPRLPAVHHHHHHHH
AVWPPGAATVLQPAPSLWTPGPP*
a.a.
length
InterPro Name
length(64), motif(135:198) 64 IPR027904 Domain of unknown function DUF4587 [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000091166
H-Inv cluster ID Locus viewHIX0203120
Accession number BC026042.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Similar to Uncharacterized protein C21orf58;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (P58505)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 108309531170707214702039ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol C21orf58
HGNC aliases NA
HGNC name chromosome 21 open reading frame 58
DDBJ NA
UniProt C21orf58
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000336897
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:54058
KEGG GENES KEGG GENES(54058)
GeneCard GeneCardC21orf58*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA


Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear;  mitochondria;  Other; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus NA
HG-U133 238541_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 238541_at; 
HG-U133_Plus_2 1555197_a_at;  1555198_x_at;  1559438_at;  1559439_s_at;  238541_at; 
HG-U95 71899_at;  87097_at; 
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D 71899_at; 
HG-U95E 87097_at; 
HG-U95Av2 NA
HuEx-1_0 3924574;  3935380;  3935381;  3935383;  3935384;  3935386;  3935387;  3935391;  3935392;  3935393;  3935394;  3935395;  3935396;  3935397;  3935398;  3935408;  3935409;  3935410; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_23_P132139; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Mus sp. (Mouse) AK011591 MGI:1910691 G-integraG-integra
Orthology Danio sp. (Zebrafish) BC093292 G-integraG-integra
Orthology Rattus sp. (Rat) BC128753 G-integraG-integra
Orthology Gallus sp. (Chicken) BX935669 G-integraG-integra
Orthology Canis sp. (Dog) ENSCAFT00000038493 G-integraG-integra
Orthology Macaca sp. (Macaque) ENSMMUT00000018109 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000013396 G-integraG-integra
Orthology Pan sp. (Chimpanzee) ENSPTRT00000026179 G-integraG-integra
Orthology Equus sp. (Horse) XM_001489518 G-integraG-integra
Orthology Bos sp. (Cow) XM_880807 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
10 .. 10 A/G rs3810592 - 5'UTR
17 .. 17 G/A rs150104675 - 5'UTR
33 .. 33 G/T rs140786971 - 5'UTR
205 .. 205 G/A rs76328736 - 5'UTR
216 .. 216 G/A rs145225596 - 5'UTR
343 .. 343 A/G rs7283068 - 5'UTR
470 ^ 471 -/A rs201200451 - 5'UTR
483 ^ 484 -/A rs140669752 - 5'UTR
737 .. 737 G/A rs140256495 - 5'UTR
892 .. 892 T/C rs80051805 - 5'UTR
893 ^ 894 -/C rs5844265 - 5'UTR
897 .. 897 C/T rs201386936 - 5'UTR
897 ^ 898 -/C rs5844264 - 5'UTR
959 .. 959 G/C rs146634405 - 5'UTR
966 ^ 967 -/C rs11368717 - 5'UTR
1148 .. 1148 C/G rs142976085 - 5'UTR
1177 .. 1177 C/T rs150244712 - 5'UTR
1195 .. 1195 C/G rs141324456 - 5'UTR
1244 .. 1244 C/T rs146609305 - 5'UTR
1245 .. 1245 T/A rs144470839 - 5'UTR
1249 .. 1249 G/A rs139770901 - 5'UTR
1258 .. 1258 G/T rs200456158 - 5'UTR
1260 .. 1260 C/G rs150924884 - 5'UTR
1261 .. 1261 C/T rs77001490 - 5'UTR
1262 .. 1262 G/A rs117585672 - 5'UTR
1263 .. 1263 C/T rs191101662 - 5'UTR
1278 .. 1278 C/T rs148426190 - 5'UTR
1279 .. 1279 G/T rs149778986 - 5'UTR
1311 .. 1311 T/A rs142758046 - 5'UTR
1312 .. 1312 G/T rs140471886 - 5'UTR
1314 .. 1314 G/A rs147199055 - 5'UTR
1318 .. 1318 A/G rs143711780 - 5'UTR
1337 .. 1337 G/A rs139612839 - 5'UTR
1343 .. 1343 T/C rs138106041 - 5'UTR
1360 .. 1360 C/T rs80138297 - 5'UTR
1367 .. 1367 C/T rs150599402 - 5'UTR
1368 .. 1368 G/A rs141733450 - 5'UTR
1387 .. 1387 A/G rs145032370 - 5'UTR
1460 .. 1460 C/G rs186065102 - 5'UTR
1476 .. 1476 A/G rs182157125 - 5'UTR
1550 .. 1550 C/T rs141306262 - 5'UTR
1590 .. 1590 A/T rs188324762 - 5'UTR
1596 .. 1596 G/A rs199568321 - 5'UTR
1600 .. 1600 G/A rs146598443 - 5'UTR
1604 .. 1604 G/A rs77907804 - 5'UTR
1607 .. 1607 C/T rs185555820 - 5'UTR
1659 .. 1659 C/T rs140707382 - 5'UTR
1675 .. 1675 T/C rs192271541 - 5'UTR
1720 .. 1720 G/A rs73373840 - CDS Nonsynonymous[Gly13Arg]
1727 .. 1727 C/T rs186988808 - CDS Nonsynonymous[Ala15Val]
1781 .. 1781 C/T rs114869542 - CDS Nonsynonymous[Ala33Val]
1783 .. 1783 T/C rs117095783 - CDS Synonymous[Leu34Leu]
1801 .. 1801 G/C/A rs75798864 - CDS
1848 .. 1848 C/T rs56036022 - CDS Synonymous[Asp55Asp]
1892 .. 1892 C/T rs144154606 - CDS Nonsynonymous[Ala70Val]
1912 .. 1912 C/T rs139267300 - CDS Nonsynonymous[Pro77Ser]
1929 .. 1929 G/A rs111338441 - CDS Synonymous[Thr82Thr]
1932 .. 1932 C/T rs113833376 - CDS Synonymous[Gly83Gly]
1958 .. 1958 C/T rs117880826 - CDS Nonsynonymous[Pro92Leu]
1966 .. 1966 C/T rs13047478 - CDS Nonsynonymous[Pro95Ser]
1991 .. 1991 C/T rs149876945 - CDS Nonsynonymous[Pro103Leu]
2078 .. 2078 C/T rs13049404 - CDS Nonsynonymous[Pro132Leu]
2086 .. 2086 C/T rs138995738 - CDS Nonsynonymous[Arg135Trp]
2109 .. 2109 C/T rs151147810 - CDS Synonymous[Asp142Asp]
2200 ^ 2201 -/G rs140615070 - CDS
2201 .. 2201 A/C rs75132371 + CDS Nonsynonymous[Asp173Ala]
2218 ^ 2219 -/C rs35444111 - CDS
2259 ^ 2260 -/CAC rs35902237 - CDS
2261 ^ 2262 -/CCA rs112899928 - CDS
2279 ^ 2280 -/CAC rs72453641 - CDS
2281 ^ 2282 -/CCA rs144178764 - CDS
2282 ^ 2283 -/CCA rs71318063 - CDS
2322 .. 2322 C/T rs75421562 - CDS Synonymous[Pro213Pro]
2323 .. 2323 G/A rs115368315 - CDS Nonsynonymous[Ala214Thr]
2361 .. 2361 G/A rs149602754 - 3'UTR
2428 .. 2428 C/T rs190655683 - 3'UTR
2592 ^ 2593 -/G rs34014831 - 3'UTR
2595 .. 2595 C/G rs111446685 - 3'UTR
2595 ^ 2596 -/G rs72562362 - 3'UTR
2596 .. 2596 C/A rs112418156 - 3'UTR
2671 .. 2671 G/A rs138422828 - 3'UTR
2680 .. 2680 G/A rs146323299 - 3'UTR
2705 .. 2705 C/T rs185168883 - 3'UTR
2709 .. 2709 A/G rs180951536 - 3'UTR
2736 .. 2736 C/T rs8129883 - 3'UTR
2758 .. 2758 A/T rs11089057 - 3'UTR
2842 .. 2842 G/A rs116209545 - 3'UTR
2852 .. 2852 G/A rs189267812 - 3'UTR
2916 ^ 2917 -/A rs11443408 - 3'UTR
2919 .. 2919 T/A rs201855232 - 3'UTR
2920 .. 2920 A/T rs199725472 - 3'UTR
2922 ^ 2923 -/A rs113564822 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
AluSx3 1086 1167 -
AluJo 2638 2945 +
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer